Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1236 IGR1244 IGR1238 IGR1234 IGR1239 IGR1241 IGR1240 IGR1237 IGR1235 IGR1242 IGR1243 HD1694 greA, - HD1699 HD1698 mod, - HD1693 mod, - HD1691 res, - HD1690 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 purH, - HD1703 HD1694 greA, - HD1699 HD1698 mod, - HD1693 mod, - HD1691 res, - HD1690 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 purH, - HD1703 Type: tandem, Name:  - 18 HD1694 greA, - HD1699 HD1698 mod, - HD1693 mod, - HD1691 res, - HD1690 mod, - HD1692 mod, - HD1692 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 purH, - HD1703 tpn, - HD1695 tpn, - HD1695
* Calculated from Protein Sequence

Gene ID: HD1696

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
transposase fragment

Gene Start:
1413360

Gene Stop:
1413971

Gene Length:
612

Molecular Weight*:
24417

pI*:
9.80

Net Charge*:
7.55

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 25-201 are 37% similar to residues 188-355 of 21109571 transposase [Xanthomonas axonopodis pv. citri str. 306].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1696 is paralogously related to HD0290 (1e-121), HD1612 (2e-97), HD1689 (3e-36) and HD1616 (2e-33).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LIWTALMFTLHLRKENKKIDRLDYRLKENKSPNKRCVMVAREHFSAEEKA
ENQFNRGAKRSHVFVTYSESQPVVKDFSNRFIVRESRINTDESTAYESLL
LDYDLRTVNHKEEYRSDLGITNNQAESFFSRFKRMYYGHVHKMSNLYLLN
YANEIAYREDNRRKANGWQSQDILGKCLTTTNENNEWCGYWQRKIVHQEV
IWQ$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATATGGACGGCACTTATGTTCACCCTGCACCTCCGTAAAGAAAACAA
GAAAATCGACCGCTTGGACTATCGCTTGAAAGAAAATAAAAGTCCTAATA
AACGCTGTGTTATGGTAGCTCGTGAACATTTTTCCGCAGAAGAAAAAGCA
GAAAACCAATTTAATCGCGGGGCAAAACGTTCACACGTTTTTGTGACTTA
TTCTGAATCACAACCTGTTGTAAAAGACTTCTCAAATCGCTTTATTGTTC
GTGAAAGTCGCATTAATACAGACGAAAGTACAGCTTACGAAAGTTTATTA
CTCGACTATGATTTACGCACAGTGAATCATAAAGAAGAATATCGTAGCGA
TTTAGGCATAACCAACAATCAAGCCGAATCCTTTTTCTCTCGCTTTAAAC
GAATGTACTACGGACACGTTCACAAAATGAGTAATCTTTATTTACTCAAC
TATGCAAATGAAATCGCTTACCGTGAAGATAATCGTAGAAAAGCCAATGG
TTGGCAATCTCAGGATATTCTCGGTAAATGCTTAACAACAACTAATGAAA
ATAACGAATGGTGCGGTTATTGGCAACGGAAAATCGTTCATCAAGAAGTG
ATTTGGCAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy