Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1236 IGR1244 IGR1234 IGR1238 IGR1239 IGR1241 IGR1240 IGR1237 IGR1235 IGR1242 IGR1243 IGR1233 HD1694 greA, - HD1699 HD1698 mod, - HD1693 mod, - HD1691 res, - HD1690 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 purH, - HD1703 HD1694 greA, - HD1699 HD1698 mod, - HD1693 mod, - HD1691 res, - HD1690 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 purH, - HD1703 Type: tandem, Name:  - 18 HD1694 greA, - HD1699 HD1698 mod, - HD1693 mod, - HD1691 res, - HD1690 mod, - HD1692 mod, - HD1692 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 purH, - HD1703 tpn, - HD1695 tpn, - HD1695 purH, - HD1702
* Calculated from Protein Sequence

Gene ID: HD1694

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
1412831

Gene Stop:
1412496

Gene Length:
336

Molecular Weight*:
12608

pI*:
5.30

Net Charge*:
-2.57

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-77 are 37% similar to a (PROTEOME VC1803 COMPLETE) protein domain (PD301887) which is seen in Q9KR43_VIBCH.



Paralogs:  Local Blast Search

HD1694 is paralogously related to HD1613 (3e-19), HD0292 (6e-19) and HD1540 (9e-07).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRISERLRLICEHNHWKIKDFSELTGLPYRTIQGYIGGEREPNAEGMAAI
AKVGVNLNWLVSGEGEMFKGTEQQADLNQAEIELLNQYRAMSNELQKAIE
VSFKAINTELK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTATATCAGAAAGATTAAGGCTCATTTGTGAGCATAACCATTGGAA
AATTAAAGATTTTTCCGAGCTAACAGGATTACCCTATCGAACAATACAAG
GCTATATCGGTGGTGAGCGAGAACCGAATGCTGAGGGTATGGCTGCAATT
GCGAAAGTTGGAGTAAACCTAAATTGGTTAGTGAGTGGTGAGGGTGAGAT
GTTTAAAGGAACTGAACAGCAAGCAGATCTTAATCAAGCAGAAATTGAGC
TACTCAATCAGTATCGAGCGATGTCGAATGAATTACAAAAAGCGATAGAA
GTATCGTTTAAAGCAATTAACACAGAATTGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy