Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1236 IGR1238 IGR1234 IGR1239 IGR1241 IGR1240 IGR1237 IGR1235 IGR1242 IGR1243 IGR1233 HD1694 greA, - HD1699 HD1698 mod, - HD1693 tpn, - HD1689 mod, - HD1691 res, - HD1690 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 HD1694 greA, - HD1699 HD1698 mod, - HD1693 tpn, - HD1689 mod, - HD1691 res, - HD1690 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 Type: tandem, Name:  - 18 HD1694 greA, - HD1699 HD1698 mod, - HD1693 tpn, - HD1689 mod, - HD1691 res, - HD1690 mod, - HD1692 mod, - HD1692 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 tpn, - HD1695 tpn, - HD1695
* Calculated from Protein Sequence

Gene ID: HD1693

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mod  

Definition:
type III restriction/modification system modification methylase

Gene Start:
1412492

Gene Stop:
1411923

Gene Length:
570

Molecular Weight*:
21684

pI*:
6.20

Net Charge*:
-4.74

EC:
3.1.21.5  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to methyltransferase proteins; e.g. residues 12-189 are 61% similar to (AF060119) methyltransferase of Pasteurella haemolytica, residues 69-189 are 37% similar to (AE000573) adenine specific DNA methyltransferase in Helicobacter pylori, residues 62-180 are 37% similar to (AJ007510) type III restriction-modification system enzyme in Bacillus cereus.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2189
COG name: Adenine specific DNA methylase Mod
Functional Class: L
The phylogenetic pattern of COG2189 is a----------hUJ-------
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** PR00506 (D21 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 2.3e-06.
    PR00506A    158-170


ProDom Summary:  Protein Domain Search
Residues 139-183 are 60% similar to a (METHYLTRANSFERASE MODIFICATION COMPLETE) protein domain (PD096111) which is seen in Q9Z6H7_BBBBB.

Residues 62-189 are 56% similar to a (METHYLTRANSFERASE SYSTEM MOD III) protein domain (PD034727) which is seen in Q9X2V3_PASHA.



Paralogs:  Local Blast Search
HD1693 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LTNYFKETPKWHSTAQHSTAQHSTAQHSTAQHSTAQHSTAQHSTAQHNSL
TDNNTPFQQNNLEKLKQLFPEIFCENKIDWEKLKLVLGEENLADHNERYC
LNWAGKSNAYSILQSPSFNTLAPCKEESVNFDHTQNLFIEAENMEALKIL
QKAYAGTVKMIYIDPPYNTGNDSFIYPDKFSETREEYAK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGACAAACTATTTTAAGGAAACCCCAAAATGGCACAGCACAGCACAGCA
CAGCACAGCACAGCACAGCACAGCACAGCACAGCACAGCACAGCACAGCA
CAGCACAGCACAGCACAGCACAGCACAGCACAGCACAGCACAATAGTTTA
ACGGATAACAACACTCCTTTCCAACAAAACAATCTTGAAAAGCTCAAACA
GCTTTTTCCTGAGATTTTTTGTGAAAATAAAATTGATTGGGAAAAACTAA
AACTCGTGTTAGGTGAAGAAAACCTAGCTGATCATAATGAGCGTTACTGT
CTAAACTGGGCGGGTAAATCAAATGCTTATAGCATCTTACAATCTCCATC
TTTTAACACCCTTGCCCCCTGTAAAGAAGAAAGCGTGAATTTTGACCACA
CACAAAATCTGTTTATTGAAGCCGAGAATATGGAAGCCTTGAAAATTCTG
CAAAAGGCTTACGCAGGCACGGTGAAGATGATCTACATTGACCCACCTTA
TAATACGGGCAATGATAGTTTTATTTACCCTGATAAATTTTCTGAAACGA
GAGAAGAATACGCCAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy