Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1236 IGR1234 IGR1238 IGR1232 IGR1239 IGR1241 IGR1240 IGR1237 IGR1235 IGR1233 HD1694 greA, - HD1699 HD1688 HD1698 mod, - HD1693 tpn, - HD1689 mod, - HD1691 res, - HD1690 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 HD1694 greA, - HD1699 HD1688 HD1698 mod, - HD1693 tpn, - HD1689 mod, - HD1691 res, - HD1690 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 Type: tandem, Name:  - 18 HD1694 greA, - HD1699 HD1688 HD1698 mod, - HD1693 tpn, - HD1689 mod, - HD1691 res, - HD1690 mod, - HD1692 mod, - HD1692 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 tpn, - HD1695 tpn, - HD1695
* Calculated from Protein Sequence

Gene ID: HD1691

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mod  

Definition:
site-specific DNA-methyltransferase; type III restriction-modification system methyltransferase, subunit mod

Gene Start:
1411681

Gene Stop:
1410374

Gene Length:
1308

Molecular Weight*:
48897

pI*:
7.50

Net Charge*:
1.73

EC:
 

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to probable methyltransferase protein; e.g. residues 199-432 are 45% similar to (AF060119) methyltransferase in Pasteurella haemolytica, residues 220-423 are 30% similar to (AE000573) adenine specific DNA methyltransferase in Helicobacter pylori, residues 154-309 are 37% similar to type III restriction-modification system (P12364) in E.coli.


COGS Summary:  COGS Search
BeTs to 3 clades of COG2189
COG name: Adenine specific DNA methylase Mod
Functional Class: L
The phylogenetic pattern of COG2189 is a----------hUJ-------
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** PR00506 (D21 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 2.1e-06.
    PR00506D    225-239


ProDom Summary:  Protein Domain Search
Residues 310-432 are 45% similar to a (METHYLTRANSFERASE) protein domain (PD300180) which is seen in Q9X2V3_PASHA.

Residues 229-285 are 77% similar to a (METHYLTRANSFERASE SYSTEM PROTEOME) protein domain (PD208582) which is seen in Q9CMV6_PASMU.



Paralogs:  Local Blast Search
HD1691 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 283 (E-value = 6.6e-05) place HD1691 in the N6_N4_Mtase family which is described as DNA methylase (PF01555)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LKFFTCKSVIDNKSLNEKDDFQKLVEHVLIYTKNKISFIPEKPYEEYDLS
KFCWEISELSIGKEIILGGKKVTVFKNNEYEIKKIPYSINALKETWASGS
VLKGNTSGKFFDKELSGRIDVDGYGCLYKVEGIGEDGIGHRYFTGPKKEG
ATKGKFYSGVPLKRVNEINQGESKKYNPIVNLYDYSADFGNISHEGNMVF
RGGKKPVKMLSHFIKISNVSSADLILDFFAGSGSTAHAVMQLNAEDGGNR
RYICVQLPEQTDEKSEAFKAGFSTIAEIAKERIRRAGKKIKEEHPESHID
TGFKVFKLAESNFKQWQAPKTNEVENIATQLAMFQDIVEPTATVENMAYE
LALRLGFQLTDSIEFADQVVWLNDKTGKRKTALLLAQYHNEMLNCIIGAQ
PQKVFALDKVFNGNDDLKANLALQLKDAGIAFETF$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAATTTTTTACATGCAAGTCCGTTATTGATAATAAATCATTAAATGA
AAAAGATGATTTTCAGAAATTAGTTGAACACGTTTTAATCTACACAAAAA
ATAAAATCAGTTTTATTCCTGAAAAGCCTTATGAAGAATATGATTTGTCT
AAATTTTGTTGGGAAATATCTGAATTATCAATTGGGAAAGAGATTATTTT
AGGTGGTAAAAAAGTTACTGTATTCAAGAACAATGAATATGAAATTAAAA
AAATTCCCTATTCAATCAATGCACTTAAAGAGACATGGGCAAGTGGTAGT
GTTTTAAAAGGAAATACATCAGGAAAGTTCTTTGATAAAGAATTATCAGG
TCGTATAGATGTTGATGGCTATGGCTGCCTATATAAAGTAGAAGGTATTG
GTGAAGATGGCATAGGGCACAGGTATTTTACTGGTCCTAAAAAGGAAGGA
GCAACAAAAGGTAAATTCTATTCTGGCGTGCCGCTTAAAAGAGTTAATGA
GATCAATCAAGGGGAAAGCAAAAAATACAATCCAATAGTTAATTTATATG
ATTATAGTGCTGACTTTGGAAATATTAGCCATGAGGGTAATATGGTGTTT
CGTGGCGGTAAAAAGCCAGTGAAAATGCTTAGTCATTTTATAAAAATCTC
TAATGTATCATCCGCTGATTTAATCTTAGACTTCTTTGCTGGTAGTGGTT
CAACTGCTCATGCCGTCATGCAGTTAAACGCGGAAGATGGCGGTAATCGT
CGTTATATTTGCGTACAACTGCCTGAACAAACTGACGAAAAATCAGAAGC
CTTTAAAGCAGGTTTTAGTACTATTGCCGAAATCGCCAAAGAACGCATTC
GCCGTGCGGGCAAAAAAATCAAAGAAGAACACCCTGAAAGCCATATCGAC
ACAGGCTTTAAAGTGTTTAAATTAGCCGAAAGCAATTTTAAACAATGGCA
AGCCCCGAAAACGAATGAAGTGGAAAATATCGCTACTCAACTTGCAATGT
TCCAAGATATTGTTGAACCCACTGCCACAGTGGAAAATATGGCGTATGAA
CTCGCTTTGCGTTTAGGTTTTCAATTAACGGATAGCATTGAGTTTGCCGA
TCAAGTGGTTTGGCTGAATGATAAAACAGGCAAAAGAAAAACTGCACTTT
TATTAGCACAGTATCACAATGAAATGCTTAATTGCATTATTGGCGCACAA
CCACAAAAAGTGTTTGCTTTAGATAAAGTATTTAATGGCAATGATGACTT
AAAAGCTAATCTCGCCCTGCAATTAAAAGACGCAGGTATTGCCTTTGAAA
CATTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy