Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1236 IGR1238 IGR1234 IGR1232 IGR1231 IGR1230 IGR1237 IGR1235 IGR1233 HD1687 HD1694 HD1688 mod, - HD1693 tpn, - HD1689 mod, - HD1691 bioA, - HD1685 res, - HD1690 HD1697 tpn, - HD1696 yfcB, - HD1686 HD1687 HD1694 HD1688 mod, - HD1693 tpn, - HD1689 mod, - HD1691 bioA, - HD1685 res, - HD1690 HD1697 tpn, - HD1696 yfcB, - HD1686 Type: tandem, Name:  - 18 HD1694 HD1688 mod, - HD1693 tpn, - HD1689 mod, - HD1691 bioA, - HD1685 res, - HD1690 mod, - HD1692 mod, - HD1692 HD1687 tpn, - HD1696 yfcB, - HD1686 tpn, - HD1695 tpn, - HD1695 HD1697
* Calculated from Protein Sequence

Gene ID: HD1690

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
res  

Definition:
type III restriction-modification system enzyme

Gene Start:
1410365

Gene Stop:
1407735

Gene Length:
2631

Molecular Weight*:
101138

pI*:
6.10

Net Charge*:
-10.58

EC:
3.1.21.5  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to type III restriction proteins; e.g. residues 1-874 are 27% similar to (AE000650) type III restriction enzyme R protein of Helicobacter pylori, residues 10-569 are 29% similar to (AE002474) type III restriction-modification system EcoPI enzyme of Neisseria meningitidis, residues 1-582 are 27% similar to (AJ007510) type III restriction-modification system enzyme Res of Bacillus cereus.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 580-716 are 45% similar to a (ENDONUCLEASE RESTRICTION PROTEOME PM0699) protein domain (PD415606) which is seen in Q9X2V4_PASHA.

Residues 1-570 are 55% similar to a (TYPE III SYSTEM ENZYME) protein domain (PD018586) which is seen in Q9X2V4_PASHA.

Residues 759-876 are 57% similar to a (TYPE III SYSTEM ENZYME) protein domain (PD278695) which is seen in Q9X2V4_PASHA.



Paralogs:  Local Blast Search
HD1690 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 874 (E-value = 6e-260) place HD1690 in the ResIII family which is described as Type III restriction enzyme, res subunit (PF04851)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQLKFEELTHQQQAIEAVIALFKGELNKTTEFSLNNLGSQPIMANQLALP
LEEVEKNLNAVQEKFHQKTTALSDHGLHFSVEMETGTGKTYVYLHTIFEL
NKQYGWQKFVIVVPSVAIREGVQQTVRTTAEHFTNLFDKPTVNTTVYRSD
RLNALRSFATNNQIEILIMNIDSFKKDDNVINRINESGEAPILQISQTQP
IVIIDEPQNMETDLAKQAIEALNPLFVLRYSATHKNPYHKIYSLNPLDAY
NQKLVKQIEVEPVLAENDVNGAYVVLKEPVVGKGKLKAKIEIHVQTEKET
KKKVVTIQAGDDLYEKSGKNESYRHGFIINELSADPFEIHLSNGQVLTQS
EDDDLLRDEIMKKQMECTIKEHLAKEKWLNSKGIKVLSLFFIDKVANYRD
NGKFYRWFNEIYERETGKSAVGVHNGYFSQDNKGKETDTKGNSKADEDTY
DLIMRDKEKLLSFDSPLRFIFSHSALKEGWDNPNVFQICTLNETRSPIKK
RQEIGRGLRLAVNQQGERIYDESVNILTVIPNESYQSFAANLQKEYEDEC
GIKFTNGGVKSKQARLQQHYRKGFTLDPAFIEIWQKLQQKTLYSVRFERE
KLIESAVKLMSEMPAIQRVQLNVQKAKLRQSEQGIWGEETNSRYAEIDTH
WEIPDVLQAIQRKTQLTRQTICEILQKSDRLQELANNPQRFIDMVSEKIL
QALNGLMIDGIEYSQVEPQENSYEQTLIQWQELEKNGLEIFFNEHTFEVN
QSDKEKQQKTIFANYISLDSHTEKQFAQECENNEDVRMYFKLPNWFKIPT
PIGNYNPDWAVVMNNRSKVYFVAETKNTGKGIQSGVDESLLSLTERQKIQ
CAKKHFSLNIFDGVKYQVVEKLSEIS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTAAAATTTGAAGAACTCACCCACCAACAGCAAGCCATTGAAGC
GGTGATTGCCTTATTTAAAGGCGAATTAAATAAAACCACGGAATTTTCCC
TTAATAACCTAGGCAGTCAGCCGATTATGGCAAATCAGCTGGCGTTACCC
CTTGAAGAAGTCGAGAAAAATTTAAATGCGGTGCAGGAGAAATTTCATCA
AAAAACGACCGCTCTTTCCGATCACGGTTTGCATTTTTCCGTTGAAATGG
AAACGGGTACGGGCAAAACTTATGTCTATTTACACACCATTTTTGAGTTA
AATAAACAATACGGCTGGCAGAAATTTGTGATTGTCGTGCCAAGTGTCGC
CATTCGTGAAGGCGTACAACAAACCGTACGAACCACCGCCGAACATTTTA
CTAATTTGTTTGATAAACCGACCGTTAATACCACGGTATATCGTAGCGAC
AGGCTAAATGCGCTACGCAGTTTTGCCACTAATAACCAGATTGAAATCTT
GATTATGAACATTGACAGCTTTAAAAAAGATGACAATGTGATTAACCGTA
TAAACGAGAGTGGCGAAGCCCCGATTTTGCAAATTAGCCAAACTCAGCCA
ATTGTTATCATTGATGAACCGCAAAATATGGAAACAGATTTAGCCAAACA
GGCGATAGAAGCCCTGAATCCGCTATTTGTATTGCGTTATTCTGCCACGC
ATAAAAATCCATACCATAAAATTTATAGCTTAAATCCGTTAGACGCTTAT
AACCAAAAATTGGTAAAACAAATCGAAGTCGAACCTGTGCTGGCAGAAAA
CGATGTGAACGGGGCTTATGTGGTGCTAAAAGAGCCTGTGGTTGGCAAAG
GTAAACTCAAAGCCAAAATTGAAATTCACGTTCAAACGGAGAAAGAAACG
AAGAAAAAAGTAGTTACCATTCAAGCAGGTGATGATCTCTATGAAAAATC
AGGCAAAAATGAGAGTTATCGACACGGGTTTATTATCAATGAGTTAAGTG
CCGATCCATTTGAGATCCACTTATCTAATGGGCAAGTGCTTACACAAAGT
GAAGATGATGATCTCTTGCGTGATGAAATTATGAAAAAGCAGATGGAGTG
CACCATTAAAGAGCATTTAGCCAAAGAAAAATGGCTGAATAGCAAAGGCA
TTAAAGTGCTTTCGCTGTTTTTTATTGATAAGGTGGCAAATTACCGTGAT
AACGGTAAATTTTATCGCTGGTTCAATGAAATCTATGAGCGTGAAACAGG
AAAAAGTGCGGTAGGTGTACACAATGGTTATTTTTCTCAAGATAATAAAG
GCAAAGAAACGGATACCAAAGGGAATTCAAAAGCGGACGAAGACACTTAC
GATTTAATTATGCGAGATAAAGAAAAACTGCTTTCTTTTGATTCACCGTT
ACGTTTTATTTTTTCTCATTCCGCTTTAAAAGAGGGCTGGGATAACCCAA
ATGTGTTTCAAATTTGTACGCTAAATGAAACTCGTTCACCCATTAAAAAA
CGTCAAGAAATTGGGCGAGGCTTACGTTTGGCGGTAAATCAGCAAGGCGA
ACGTATTTATGATGAAAGTGTAAATATCCTCACTGTTATTCCTAATGAAA
GCTATCAAAGTTTTGCTGCAAATCTCCAAAAAGAATATGAAGATGAATGC
GGAATTAAATTTACCAATGGTGGTGTAAAATCAAAACAAGCTCGCTTACA
ACAACATTATCGAAAAGGTTTTACCCTTGATCCCGCATTTATTGAAATTT
GGCAAAAGTTACAGCAAAAAACACTTTATTCCGTGCGATTTGAACGAGAA
AAATTGATTGAAAGTGCTGTAAAATTGATGAGCGAAATGCCTGCTATTCA
ACGGGTACAACTGAATGTACAAAAGGCAAAACTACGTCAATCTGAACAAG
GAATTTGGGGGGAAGAAACCAATTCTCGCTATGCAGAAATTGATACTCAT
TGGGAAATCCCTGATGTATTGCAAGCTATTCAGCGCAAAACCCAATTAAC
TCGCCAAACAATTTGTGAAATTTTGCAAAAATCCGACCGCTTGCAAGAGC
TTGCCAATAATCCACAACGCTTTATTGATATGGTAAGTGAGAAAATTCTA
CAAGCCTTAAATGGTTTAATGATTGATGGTATTGAGTATTCCCAAGTTGA
ACCACAAGAAAATAGCTATGAACAAACCTTAATTCAATGGCAAGAATTGG
AGAAAAATGGTTTGGAAATCTTTTTCAATGAGCATACCTTTGAAGTCAAT
CAAAGTGATAAAGAAAAACAACAAAAAACCATTTTTGCTAATTATATATC
ACTGGATTCGCACACTGAAAAACAGTTCGCCCAAGAATGTGAAAACAACG
AAGATGTGCGAATGTATTTTAAATTGCCTAACTGGTTTAAAATTCCTACC
CCAATCGGTAATTACAACCCTGACTGGGCGGTGGTAATGAATAACCGTTC
AAAAGTTTATTTTGTGGCGGAAACTAAAAATACAGGTAAAGGCATTCAAT
CAGGAGTTGATGAAAGTTTGCTTAGCTTAACTGAACGTCAAAAAATCCAA
TGCGCTAAAAAACATTTTTCTTTAAATATTTTTGATGGAGTGAAATATCA
GGTTGTAGAAAAATTATCTGAGATTAGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy