Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1234 IGR1228 IGR1232 IGR1229 IGR1231 IGR1230 IGR1235 IGR1233 HD1687 HD1688 HD1682 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1687 HD1688 HD1682 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1688 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 mod, - HD1692 mod, - HD1692 HD1687 HD1682 yfcB, - HD1686
* Calculated from Protein Sequence

Gene ID: HD1689

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
transposase

Gene Start:
1407385

Gene Stop:
1406294

Gene Length:
1092

Molecular Weight*:
42683

pI*:
10.30

Net Charge*:
21.72

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 8-357 are 35% similar to 21109571 transposase [Xanthomonas axonopodis pv. citri str. 306].

Few significant hits in gapped BLAST to protein; e.g.
residues 53-158 are 34% similar to (AF225215) putative transposase of Xanthomonas oryzae pv. oryzae, residues 28-324 are 25% similar to (AF016485) putative ISH4 transposase of Halobacterium residues 37-328 are 23% similar to(AF249895) putative transposase of Xanthomonas pv. mangiferaeindicae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 28-245 are 27% similar to a (ELEMENT TRANSPOSABLE ISH4 COMPLETE) protein domain (PD181686) which is seen in O52011_HALN1.

Residues 53-158 are 34% similar to a (MEMBRANE OUTER TRANSPOSASE TBUX) protein domain (PD039757) which is seen in Q9L792_BBBBB.



Paralogs:  Local Blast Search
HD1689 is paralogously related to HD1616 (1e-155), HD1612 (3e-74), HD0295 (1e-65), HD1696 (5e-36), HD0290 (5e-36), HD1695 (2e-34) and HD0291 (2e-34).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRGFLFSMAQHFSLSAEARHLSIQVDELSDVEILSLLKTARWGNADNIND
IECPHCHVRHEAYFIKTRQQWQCKHCCYRFSITAGTIFHLAKLSLRKILK
ALRYFALKSKGLSAIELSHEINVQYKTAWGLRHKFREALDKTKDLTPLKD
EVHIDGAYTNYYIRPKNFRHKRIDRRKKRYQREDKSCVLVFRQRAANQAQ
MKGADRSIVALIKEENTQDVLDLTQRLVKQGSTIHTDENPAYDSLQFLYD
LWRVNHSQEYCSIEGITNNLAESFFARFRRMIIGVHHKMANRYMLYYANE
IAWREDNRLKTDREKLNDVLQRCIKTKPSRHFTGYWQGSKKSPETFGLES
INASNDSHYLIAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGGGATTTTTATTTTCTATGGCACAGCATTTTTCGCTATCTGCAGA
GGCACGCCACTTGTCTATACAAGTGGACGAGCTTTCTGATGTCGAAATTT
TGTCGTTGCTGAAAACCGCTCGTTGGGGCAATGCTGATAATATAAATGAT
ATTGAATGTCCGCATTGTCACGTTAGACACGAAGCCTACTTCATTAAAAC
TCGCCAACAATGGCAATGTAAGCATTGTTGCTATCGCTTTTCAATTACTG
CAGGCACAATATTTCACCTTGCTAAATTATCACTGCGAAAGATATTAAAA
GCCTTACGTTATTTTGCACTTAAAAGCAAAGGATTATCTGCTATTGAGCT
TTCTCACGAAATTAACGTGCAATATAAAACAGCGTGGGGGCTACGTCATA
AATTCCGTGAAGCTTTAGATAAAACCAAAGATTTAACACCGCTGAAAGAT
GAAGTGCATATTGATGGTGCATATACCAATTATTACATTCGCCCTAAAAA
CTTCCGCCATAAACGCATTGATAGAAGAAAGAAACGTTATCAACGTGAAG
ATAAGTCGTGTGTATTGGTATTCCGCCAACGTGCAGCAAATCAAGCACAA
ATGAAAGGAGCAGACAGAAGTATTGTCGCTTTAATCAAAGAAGAAAATAC
GCAAGATGTTCTCGACCTTACGCAACGTTTAGTCAAGCAAGGCTCAACCA
TTCATACAGATGAAAACCCTGCTTACGATAGCTTGCAGTTTTTATATGAC
TTATGGCGAGTAAATCATTCTCAAGAATATTGTTCTATTGAGGGAATAAC
CAATAATCTTGCGGAATCTTTCTTTGCTCGTTTTCGCAGAATGATAATCG
GCGTACATCACAAAATGGCAAACCGCTATATGCTTTACTATGCCAATGAA
ATTGCGTGGCGTGAAGATAATCGCCTTAAAACAGACCGAGAGAAATTGAA
TGATGTACTTCAACGTTGCATTAAAACTAAACCCTCAAGGCATTTTACAG
GCTATTGGCAAGGAAGTAAGAAGTCACCTGAAACCTTTGGCTTAGAAAGT
ATCAACGCTTCAAACGATTCACATTATTTAATCGCAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy