Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1234 IGR1228 IGR1232 IGR1229 IGR1231 IGR1230 IGR1233 HD1687 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1687 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1688 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 HD1682 bioC, - HD1681 HD1687 HD1682 yfcB, - HD1686
* Calculated from Protein Sequence

Gene ID: HD1688

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
1406277

Gene Stop:
1405786

Gene Length:
492

Molecular Weight*:
19060

pI*:
5.20

Net Charge*:
-3.65

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1688 is paralogously related to HD0296 (3e-92) and HD1618 (1e-24).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKLRNMENSPINTDLAVMDYEEFKCFMKELATMYSDISDNGYPLLYDTLR
KISKAIATRPFEYHIIYGAYEIANKQVVVAIFEMQFNETNLGRTSVSFAE
DKLHLNCPSKVRKQLTQQDYITSAESAYPCIMEEMLFDKIRERREKERRS
VTPLTKEELEALS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTACGTAATATGGAAAATTCACCGATTAATACCGATTTAGCCGT
AATGGATTATGAAGAATTTAAGTGCTTTATGAAAGAATTAGCCACAATGT
ATTCCGATATATCAGATAATGGCTACCCATTACTTTATGATACTTTACGA
AAAATCAGTAAGGCGATAGCCACACGTCCTTTTGAATACCATATTATTTA
TGGAGCGTATGAAATCGCCAATAAACAAGTGGTAGTCGCTATTTTTGAAA
TGCAATTTAATGAAACAAATCTCGGTCGTACTTCCGTCAGTTTTGCCGAA
GATAAACTGCATTTAAATTGTCCGTCCAAAGTCCGAAAACAACTTACCCA
ACAGGACTATATCACTTCCGCAGAGAGCGCCTATCCTTGCATTATGGAAG
AAATGCTATTTGATAAAATTCGAGAAAGACGAGAAAAGGAAAGAAGAAGT
GTAACCCCTTTAACCAAAGAGGAATTAGAAGCACTTAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy