Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1234 IGR1228 IGR1232 IGR1229 IGR1231 IGR1230 IGR1233 HD1687 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1687 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 mod, - HD1691 bioA, - HD1685 res, - HD1690 HD1682 HD1682 HD1687 yfcB, - HD1686
* Calculated from Protein Sequence

Gene ID: HD1687

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
1405701

Gene Stop:
1405597

Gene Length:
105

Molecular Weight*:
3968

pI*:
8.10

Net Charge*:
1.12

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No hits in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD1687 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRLKLNLGFVQLLHNTANFDRFCCFLIMQINDGV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGTTAAAGTTAAATTTGGGTTTTGTGCAACTGCTACATAATACCGC
AAATTTTGACCGCTTTTGTTGCTTTTTGATTATGCAAATAAATGATGGTG
TTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy