Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1228 IGR1232 IGR1229 IGR1231 IGR1230 IGR1233 HD1687 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1687 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1688 bioC, - HD1681 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 res, - HD1690 bioD, - HD1680 HD1682 bioD, - HD1680 HD1682 HD1687 yfcB, - HD1686
* Calculated from Protein Sequence

Gene ID: HD1686

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yfcB  

Definition:
adenine-specific methylase

Gene Start:
1404678

Gene Stop:
1405622

Gene Length:
945

Molecular Weight*:
35444

pI*:
4.40

Net Charge*:
-22.80

EC:
2.1.1.72  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to putative adenine-specific methylase protein; e.g. residues 4-313 are 64% similar to(U32799) putative adenine specific methylase of Haemophilus influenzae, residues 7-314 are 59% similar to (AE000321) putative adenine-specific methylase of Escherichia coli, residues 12-307 are 43% similar to (AE002516) putative adenine specific methylase of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class: R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 11

Blocks Summary:  Blocks Search
***** PR00507 (N12 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 1.7e-06.
    PR00507B    144-158
    PR00507C    209-221


ProDom Summary:  Protein Domain Search
Residues 209-271 are 80% similar to a (METHYLTRANSFERASE COMPLETE PROTEOME METHYLASE HOMOLOG) protein domain (PD005237) which is seen in YFCB_HAEIN.

Residues 142-200 are 77% similar to a (METHYLTRANSFERASE COMPLETE PROTEOME ARGININE) protein domain (PD006760) which is seen in Q9CNN7_PASMU.

Residues 4-53 are 60% similar to a (METHYLTRANSFERASE METHYLASE COMPLETE) protein domain (PD033742) which is seen in Q9CNN7_PASMU.

Residues 141-199 are 57% similar to a (COMPLETE PROTEOME METHYLTRANSFERASE) protein domain (PD016907) which is seen in Q9I347_PSEAE.

Residues 272-313 are 71% similar to a (METHYLASE METHYLTRANSFERASE) protein domain (PD031794) which is seen in Q9CNN7_PASMU.

Residues 144-204 are 78% similar to a (PROTEOME ADENINE-SPECIFIC) protein domain (PD412776) which is seen in YFCB_HAEIN.

Residues 209-271 are 63% similar to a (PROTEOME COMPLETE METHYLTRANSFERASE) protein domain (PD288544) which is seen in Q9KQ83_VIBCH.

Residues 55-122 are 57% similar to a (COMPLETE PROTEOME METHYLTRANSFERASE) protein domain (PD001640) which is seen in YFCB_HAEIN.



Paralogs:  Local Blast Search
HD1686 is paralogously related to HD0855 (1e-20), HD0210 (3e-08) and HD0168 (0.001).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MFEHNLELLEEIFDSSTKEDLKTIQDMMRWSYSYFNASDIYYGHGSDNAW
DEANQLVLNGLSLPIDVPETMYSSNITRIEKERIIDMISQRLGMRKPVAY
LTNSAWFCGTEYYVDERVIVPRSPIGELIQQGFTGILHAEPKRILDLCTG
SGCIAIACAQRFPNAEIDAVDLSIDALDVAQINIERHQVAHQVFPISSNL
FSDIPQDKYDLIVTNPPYVDEEDLNEMPYEFQHEPKLALGSGVDGLDITK
QTLAKAPDYLTDNGVLVCEVGNSMLHLIEQFPAVPFNWITLKNGGVGVFS
LTREELVKHHHLFA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTGAACATAATTTAGAATTGTTGGAAGAAATATTTGATTCATCAAC
GAAAGAGGATCTAAAAACAATCCAAGATATGATGCGTTGGAGTTATAGCT
ATTTTAATGCTTCAGATATTTATTATGGTCATGGTTCAGATAATGCTTGG
GACGAAGCAAATCAATTAGTGTTAAACGGATTAAGTTTGCCGATTGATGT
ACCTGAAACAATGTATTCATCAAATATTACTCGTATTGAAAAAGAACGCA
TTATTGATATGATTTCGCAACGCTTAGGTATGCGTAAACCCGTGGCTTAC
TTAACCAACTCCGCGTGGTTCTGTGGTACAGAATATTATGTTGATGAACG
AGTGATCGTACCTCGATCGCCAATTGGTGAATTAATTCAACAGGGTTTTA
CGGGTATTTTACACGCCGAACCAAAACGTATTTTAGATCTGTGTACCGGT
AGCGGTTGCATTGCTATCGCTTGTGCACAACGTTTTCCAAATGCCGAAAT
AGATGCGGTTGATTTATCGATAGATGCGTTAGATGTTGCGCAAATTAATA
TCGAACGCCATCAAGTCGCGCATCAAGTCTTCCCTATCAGCTCTAATTTA
TTTAGTGATATTCCACAAGATAAATATGATCTGATTGTAACCAATCCACC
TTATGTAGATGAAGAAGATTTAAATGAAATGCCATATGAATTCCAACACG
AACCAAAACTTGCACTAGGTTCTGGAGTAGATGGCTTAGACATTACTAAA
CAAACCTTAGCCAAAGCACCTGATTATTTAACGGATAACGGCGTGTTAGT
TTGTGAGGTTGGCAACAGTATGTTGCATTTAATCGAACAATTCCCGGCAG
TACCATTTAATTGGATTACATTAAAAAATGGCGGTGTTGGCGTATTTAGC
CTAACTCGTGAAGAATTAGTTAAACACCATCATTTATTTGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy