Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1228 IGR1232 IGR1229 IGR1231 IGR1230 IGR1227 IGR1233 HD1687 HD1688 HD1679 bioC, - HD1681 HD1678 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1687 HD1688 HD1679 bioC, - HD1681 HD1678 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 res, - HD1690 yfcB, - HD1686 HD1688 bioC, - HD1681 HD1678 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 res, - HD1690 bioD, - HD1680 HD1682 bioD, - HD1680 HD1682 HD1687 HD1679 yfcB, - HD1686
* Calculated from Protein Sequence

Gene ID: HD1685

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
bioA  

Definition:
adenosylmethionine-8-amino-7-oxononanoate (7,8-diamino-perlargonic acid ATase)

Gene Start:
1404587

Gene Stop:
1403274

Gene Length:
1314

Molecular Weight*:
48490

pI*:
6.50

Net Charge*:
-3.43

EC:
2.6.1.62  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Sakurai N, Akatsuka H, Kawai E, Imai Y, Komatsubara S.
Complete sequence and organization of the Serratia marcescens biotin operon.
Microbiology. 1996 Nov;142 ( Pt 11):3295-303.
PMID: 8969526

Bower S, Perkins JB, Yocum RR, Howitt CL, Rahaim P, Pero J. Cloning, sequencing, and characterization of the Bacillus subtilis biotin biosynthetic operon.
J Bacteriol. 1996 Jul;178(14):4122-30.
PMID: 8763940

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to protein; e.g.
residues 6-435 are 67% similar to (U32830) adenosylmethionine-8-amino-7-oxononanoate aminotransferase Haemophilus influenzae, residues 3-433 are 57% similar to (AE002428) adenosylmethionine-8-amino-7-oxononanoate aminotransferase of Neisseria meningitidis, residues 7-428 are 57% similar to (AF191556) adenosylmethionine-8-amino-7-oxononanoate aminotransferase of Xenorhabdus nematophilus.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0161
COG name: Adenosylmethionine-8-amino-7-oxononanoate aminotranferase
Functional Class:  H
The phylogenetic pattern of COG0161 is -m--yq--eBRhuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000954 (Aminotransferase class-III pyridoxal-phosphate) with a combined E-value of 8e-55.
    IPB000954A    40-69
    IPB000954B    226-265
    IPB000954C    274-289
    IPB000954D    316-334


ProDom Summary:  Protein Domain Search
Residues 220-280 are 80% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD000465) which is seen in Q9CJU1_PASMU.

Residues 92-330 are 35% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in OAT_ECOLI.

Residues 17-60 are 72% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE PROTEOME COMPLETE) protein domain (PD000493) which is seen in Q9K086_NEIMB.

Residues 165-219 are 69% similar to a (AMINOTRANSFERASE) protein domain (PD005247) which is seen in Q9CJU1_PASMU.

Residues 393-431 are 61% similar to a (AMINOTRANSFERASE) protein domain (PD006634) which is seen in BIOA_HAEIN.

Residues 325-430 are 44% similar to a (AMINOTRANSFERASE) protein domain (PD414812) which is seen in BIOA_MYCLE.

Residues 284-324 are 68% similar to a (AMINOTRANSFERASE) protein domain (PD066084) which is seen in BIOA_HAEIN.

Residues 61-99 are 71% similar to a (AMINOTRANSFERASE) protein domain (PD347560) which is seen in Q9KSZ5_VIBCH.

Residues 325-390 are 53% similar to a (AMINOTRANSFERASE) protein domain (PD369233) which is seen in Q9RMP4_XENNE.

Residues 262-324 are 66% similar to a (AMINOTRANSFERASE COMPLETE PROTEOME) protein domain (PD249119) which is seen in BIOA_SERMA.

Residues 106-164 are 55% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE COMPLETE PROTEOME) protein domain (PD186083) which is seen in Q9K086_NEIMB.

Residues 10-60 are 70% similar to a (AMINOTRANSFERASE) protein domain (PD368979) which is seen in BIOA_SERMA.



Paralogs:  Local Blast Search


HD1685 is paralogously related to HD0892 (2e-32) and HD0729 (5e-26).


Pfam Summary:  Pfam Search
Residues 19 to 435 (E-value = 7.8e-161) place HD1685 in the Aminotran_3 family which is described as Aminotransferase class-III (PF00202)

PDB Hit:
pdb|1QJ3|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic ... 489 2e-139
pdb|1DTY|A Chain A, Crystal Structure Of Adenosylmethionine-8-A... 488 4e-139
pdb|1GBN|A Chain A, Human Ornithine Aminotransferase Complexed ... 121 2e-028

Gene Protein Sequence:
MKVSELIDLDQQHIWHPYSSMTDPIPVYPVESANGVKIRLKDGRDLIDGM
SSWWAALHGYNHPRLNQAAINQLQKMSHIMFGGLTHEPAVKLCQKLLEIL
PLSLNKIFFADSGSVAVEVAMKMALQYQQAKASQIGAAKTSRTRAKFATI
RAGYHGDTWLAMSVCDPVTGMHGLFNSSLPVQFFLPQPSIKFGEPWQDTA
IQPLQDLFEQHANEIAALILEPIVQGAGGMYFYSPVYLQKARELCDQFGI
LLIFDEIATGFGRTGKLFALEYANVVPDILCLGKALTGGYLTLSAAITTT
AVANIICEGEAKCFMHGPTFMANPLACAIAYESINLLLATDWRSNIQRIE
QQLTQQLAIAKQFNAVADVRVLGAIGVIEMREPVDLVQLQHYFVEHGIWV
RPFGKLVYIMPPFIISEAELTFLTSQLIAVLRKVYNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTAAGTGAGCTTATTGACCTAGATCAGCAACATATTTGGCACCC
TTACTCTTCAATGACTGATCCTATCCCCGTTTACCCCGTTGAATCAGCTA
ACGGCGTGAAAATTCGCTTAAAAGATGGTCGTGATTTAATTGATGGAATG
TCTTCATGGTGGGCTGCATTACATGGCTATAATCACCCGCGCTTAAATCA
AGCAGCAATCAATCAGTTACAGAAAATGAGCCATATTATGTTTGGTGGTT
TGACACATGAACCAGCGGTTAAGCTTTGCCAAAAATTATTAGAAATTTTA
CCGCTTAGCTTAAATAAAATCTTTTTTGCGGATAGCGGCTCTGTTGCAGT
AGAAGTTGCGATGAAAATGGCATTACAGTATCAACAAGCTAAAGCATCGC
AAATAGGCGCAGCCAAAACATCAAGAACGCGCGCAAAATTTGCTACTATT
CGCGCCGGTTATCACGGCGATACGTGGCTTGCTATGTCTGTTTGTGATCC
AGTTACGGGAATGCACGGCCTGTTTAATTCAAGTTTACCCGTTCAGTTTT
TTTTGCCACAGCCAAGCATCAAATTTGGCGAACCGTGGCAAGACACTGCT
ATACAGCCATTACAAGATTTATTTGAACAGCATGCTAATGAAATTGCTGC
CTTGATTCTTGAGCCGATTGTGCAAGGCGCAGGAGGAATGTATTTTTATT
CACCCGTTTATTTGCAAAAAGCACGTGAATTATGCGATCAATTTGGTATT
TTGTTAATTTTTGATGAGATTGCCACCGGATTTGGTCGAACGGGTAAATT
GTTTGCTTTAGAATATGCGAATGTCGTACCCGATATTCTTTGCTTAGGCA
AAGCATTGACCGGGGGATATCTAACGCTTTCAGCGGCCATTACGACTACC
GCAGTAGCTAATATTATTTGCGAAGGCGAAGCAAAATGCTTTATGCATGG
CCCTACTTTTATGGCTAATCCATTAGCGTGTGCGATTGCTTATGAATCAA
TTAATTTATTATTAGCCACTGATTGGCGGTCAAATATTCAACGTATTGAA
CAACAACTTACTCAGCAATTAGCTATTGCAAAACAGTTCAACGCAGTGGC
TGATGTGCGTGTGCTAGGTGCAATTGGTGTAATCGAAATGCGAGAACCGG
TTGATTTAGTACAGTTACAGCACTATTTCGTTGAGCACGGTATTTGGGTC
AGACCATTTGGCAAATTAGTGTACATTATGCCACCCTTTATTATTAGCGA
AGCTGAGTTAACTTTTTTAACTAGTCAATTAATTGCAGTATTGAGAAAAG
TATATAACGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy