Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1228 IGR1232 IGR1226 IGR1229 IGR1231 IGR1230 IGR1227 IGR1233 HD1687 HD1688 HD1679 bioC, - HD1681 HD1678 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 yfcB, - HD1686 HD1687 HD1688 HD1679 bioC, - HD1681 HD1678 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 yfcB, - HD1686 HD1688 bioC, - HD1681 HD1678 tpn, - HD1689 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 bioD, - HD1680 HD1682 bioD, - HD1680 HD1682 HD1679 HD1687 yfcB, - HD1686
* Calculated from Protein Sequence

Gene ID: HD1684

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
bioF  

Definition:
8-amino-7-oxonoanoate synthase

Gene Start:
1403190

Gene Stop:
1402027

Gene Length:
1164

Molecular Weight*:
43350

pI*:
7.10

Net Charge*:
0.37

EC:
2.3.1.47  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Sakurai N, Akatsuka H, Kawai E, Imai Y, Komatsubara S.
Complete sequence and organization of the Serratia marcescens biotin operon.
Microbiology. 1996 Nov;142 ( Pt 11):3295-303.
PMID: 8969526

Bower S, Perkins JB, Yocum RR, Howitt CL, Rahaim P, Pero J. Cloning, sequencing, and characterization of the Bacillus subtilis biotin biosynthetic operon.
J Bacteriol. 1996 Jul;178(14):4122-30.
PMID: 8763940

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 8-amino-7-oxonoanoate synthase protein; e.g. residues 1-380 are 63% similar to (U32830) 8-amino-7-oxononanoate synthase of Haemophilus influenzae, residues 1-387 are 62% similar to (AL162757) 8-amino-7-oxonoanoate synthase of Neisseria meningitidis, residues 8-387 are 45% similar to (AL139074) 8-amino-7-oxononanoate synthase of Campylobacter jejuni.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0156
COG name: Biotin biosynthesis protein BioF and related aminotransferases
Functional Class:  H
The phylogenetic pattern of COG0156 is -m-kYq-cEBRhuj----iNx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003408 (Aminolevulinic acid synthase domain) with a combined E-value of 1.8e-20.
    IPB003408C    109-163
    IPB003408D    187-228
    IPB003408E    245-290
    IPB003408F    299-335
    IPB003408G    341-375
***** IPB001917 (Aminotransferases class-II) with a combined E-value of 1.3e-12.
    IPB001917A    71-82
    IPB001917B    129-140
    IPB001917C    206-220


ProDom Summary:  Protein Domain Search
Residues 321-384 are 64% similar to a (SYNTHASE TRANSFERASE ACYLTRANSFERASE SYNTHETASE ACID) protein domain (PD001038) which is seen in Q9CJU0_PASMU.

Residues 77-224 are 72% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in BIOF_HAEIN.

Residues 225-275 are 72% similar to a (SYNTHASE PROTEOME 8-AMINO-7-OXONONANOATE) protein domain (PD406073) which is seen in BIOF_HAEIN.

Residues 256-317 are 45% similar to a (PROTEOME COMPLETE 8-AMINO-7-OXONONANOATE) protein domain (PD233364) which is seen in Q9PIJ3_CAMJE.

Residues 220-275 are 73% similar to a (SYNTHASE 8-AMINO-7-OXONONANOATE) protein domain (PD196326) which is seen in Q9CJU0_PASMU.



Paralogs:  Local Blast Search


HD1684 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 78 to 386 (E-value = 1.2e-37) place HD1684 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

PDB Hit:
pdb|1BS0|A Chain A, Plp-Dependent Acyl-Coa Synthase 199 4e-052
pdb|1DJ9|A Chain A, Crystal Structure Of 8-Amino-7-Oxonanoate S... 196 4e-051

Gene Protein Sequence:
MSYFAEKLAELAQVGLNRSLPEIEHQGKWIIAQNRKMLNFSSNDYLGLAS
DTELQQTFLQNILQEAPLHQWFSSSSSRLLTGNFPIYARLEQLLAQRFQR
ETALLFNSGYHANIGILPALVDKHSLILADKLVHASLIDGTRLAGCDFYR
YQHNNLAHLTQLLEKHTGQYRRIIIVTESVFSMDGDVAPLPQLVALKKAF
SSQTEVMLYVDEAHAIGVYGANGLGMAEFFDCIDDIDLLVGTFGKALASM
GAYLICDQLIKQYLVNTMRPLIFSTALAPINVAWTHFLFEKLPQFQPKRA
HLARLSQQLKQAVELRNGDTLATQSCIVPFVVGENRQAVEKSQYLQQQGY
YCLPIRPPTVPKGTARIRFSLTADLTEAELNGLIACL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTATTTTGCCGAAAAATTAGCTGAACTTGCTCAAGTTGGCTTAAA
TCGATCATTACCCGAGATTGAGCATCAAGGTAAATGGATTATTGCTCAAA
ATAGAAAAATGTTAAATTTTTCTTCAAATGATTATTTAGGGCTTGCTTCA
GATACCGAATTACAACAAACTTTTTTGCAAAATATCTTGCAAGAAGCACC
GCTTCATCAGTGGTTTAGTTCATCGTCTTCGCGTTTGTTAACGGGGAATT
TTCCCATTTATGCGCGATTAGAGCAACTACTGGCACAACGTTTTCAGCGC
GAAACGGCTTTATTATTTAATAGTGGTTATCATGCTAATATTGGTATCTT
GCCAGCCTTAGTAGATAAACATAGCTTGATCTTGGCAGATAAATTAGTGC
ATGCGAGTTTAATTGATGGAACCCGTTTAGCAGGCTGTGATTTTTATCGC
TATCAACATAATAATTTGGCACATTTAACACAATTGCTTGAAAAACATAC
AGGGCAATATAGGCGTATTATCATTGTAACAGAAAGCGTATTTAGTATGG
ACGGCGATGTAGCGCCTTTGCCACAACTGGTTGCACTTAAAAAGGCGTTT
AGCTCACAAACAGAAGTTATGTTGTATGTTGATGAAGCACACGCGATAGG
CGTGTATGGTGCCAATGGCTTAGGAATGGCGGAATTTTTTGATTGTATTG
ATGATATTGATTTATTGGTCGGGACTTTTGGCAAAGCTTTGGCATCAATG
GGGGCTTATTTAATTTGTGATCAGCTCATTAAACAATATTTGGTCAATAC
AATGCGGCCGTTAATTTTTTCGACTGCGTTAGCGCCAATTAATGTCGCTT
GGACTCATTTTTTATTTGAAAAATTGCCACAGTTTCAGCCCAAACGAGCA
CATCTTGCACGGTTAAGCCAGCAATTAAAACAAGCGGTTGAATTACGAAA
TGGTGATACTTTAGCGACTCAAAGTTGTATTGTGCCTTTTGTGGTTGGAG
AAAATAGGCAAGCAGTCGAAAAATCACAATATTTACAACAACAAGGCTAT
TATTGTTTACCAATTAGGCCGCCAACTGTACCCAAAGGTACGGCTAGAAT
TAGATTTTCATTAACAGCAGATTTAACAGAAGCTGAATTAAATGGCTTAA
TTGCTTGCTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy