Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1225 IGR1228 IGR1226 IGR1229 IGR1231 IGR1230 IGR1227 IGR1224 HD1687 arcB, - HD1674 HD1688 HD1679 bioC, - HD1681 HD1678 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 oppF, - HD1672 yfcB, - HD1686 HD1687 arcB, - HD1674 HD1688 HD1679 bioC, - HD1681 HD1678 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 oppF, - HD1672 yfcB, - HD1686 HD1688 bioC, - HD1681 HD1678 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 HD1675 bioD, - HD1680 HD1682 bioD, - HD1680 HD1682 arcB, - HD1674 HD1679 HD1687 HD1675 oppF, - HD1672 yfcB, - HD1686
* Calculated from Protein Sequence

Gene ID: HD1681

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
bioC  

Definition:
biotin synthesis protein

Gene Start:
1401370

Gene Stop:
1400582

Gene Length:
789

Molecular Weight*:
29829

pI*:
8.80

Net Charge*:
5.25

EC:
 

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table

Secondary Evidence:
Sakurai N, Akatsuka H, Kawai E, Imai Y, Komatsubara S.
Complete sequence and organization of the Serratia marcescens biotin operon.
Microbiology. 1996 Nov;142 ( Pt 11):3295-303.
PMID: 8969526

Bower S, Perkins JB, Yocum RR, Howitt CL, Rahaim P, Pero J. Cloning, sequencing, and characterization of the Bacillus subtilis biotin biosynthetic operon.
J Bacteriol. 1996 Jul;178(14):4122-30.
PMID: 8763940

Comment:
For other biotin-related genes, see HD0634, HD0635, HD1007, HD1394, HD1480, HD1680, HD0082.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to biotin synthesis protein; e.g. residues 4-256 are 38% similar to (AE002404) biotin synthesis protein, putative of Neisseria meningitidis, residues 4-256 are 37% similar to (U32830) biotin synthesis protein, putative of Haemophilus influenzae, residues 23-256 are 28% similar to (AL139074) putative biotin synthesis protein of Campylobacter jejuni.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 11

Blocks Summary:  Blocks Search
***** IPB000339 (ubiE/COQ5 methyltransferase family) with a combined E-value of 1.6e-08.
    IPB000339B    52-66
    IPB000339C    75-92
    IPB000339D    115-157


ProDom Summary:  Protein Domain Search
Residues 122-256 are 45% similar to a (PROTEOME COMPLETE BIOTIN SYNTHESIS) protein domain (PD122671) which is seen in Q9CJT8_PASMU.

Residues 4-121 are 31% similar to a (BIOTIN PROTEOME SYNTHESIS BIOC) protein domain (PD407453) which is seen in Q9JT30_NEIMA.



Paralogs:  Local Blast Search


HD1681 is paralogously related to HD0719 (3e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LGTAMAKLAKQLIAKRFVSHLTEYDQYAIAQQQINHQLVDLLQANTDKTF
QRALEIGCGTGNLTEKLLAKIPIEHLTLNDFNAIYYPTVLQKIKQKKPLV
VVDFMQGDAEQLVFTRNFDLVSAASVVQWFDSPQQFLRNSAYALKPGGVV
LFNSFSPLNLQEIRQLTGIGLNYPTRLQWQEWLAQDFEQCQLIEQPIKLT
FDSPLAVLIHLKKTGVTAVSNKPWNRHQIKQFCMEYQAHFACEQGVYLTY
TPILMLGIKKNG$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGGAACAGCTATGGCAAAATTAGCAAAACAGCTGATTGCTAAACGATT
TGTTAGCCATTTAACTGAGTATGATCAGTATGCTATTGCTCAGCAACAAA
TTAATCATCAGCTAGTTGATTTATTACAAGCAAACACAGATAAGACTTTT
CAACGCGCACTTGAAATTGGGTGTGGCACAGGCAATTTAACTGAAAAACT
ATTAGCTAAAATCCCGATTGAACACCTCACATTAAATGATTTTAACGCGA
TTTATTATCCGACGGTATTGCAAAAAATAAAACAGAAAAAACCGCTAGTA
GTTGTTGATTTTATGCAAGGTGATGCTGAACAGCTTGTTTTTACACGCAA
TTTTGATTTAGTCAGTGCAGCTTCAGTCGTGCAATGGTTTGATAGTCCGC
AACAATTTTTACGCAATAGTGCATATGCATTAAAGCCGGGAGGCGTGGTT
TTATTTAATAGTTTTTCACCATTAAATTTGCAAGAAATTCGTCAACTAAC
GGGTATAGGCCTGAATTATCCAACACGATTGCAATGGCAAGAATGGCTGG
CACAGGATTTTGAGCAATGTCAGCTTATTGAACAACCGATTAAATTAACG
TTCGATTCACCGTTAGCGGTCTTAATTCATTTGAAAAAAACGGGTGTGAC
TGCGGTATCTAATAAACCTTGGAACCGTCACCAAATTAAGCAATTTTGTA
TGGAATACCAAGCACATTTTGCTTGTGAGCAAGGTGTTTATTTAACGTAT
ACGCCTATTTTAATGTTGGGAATAAAGAAAAATGGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy