Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1225 IGR1228 IGR1223 IGR1226 IGR1229 IGR1230 IGR1227 IGR1224 arcB, - HD1674 HD1679 bioC, - HD1681 HD1678 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 oppF, - HD1672 yfcB, - HD1686 oppD, - HD1671 arcB, - HD1674 HD1679 bioC, - HD1681 HD1678 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 oppF, - HD1672 yfcB, - HD1686 oppD, - HD1671 bioC, - HD1681 HD1678 bioF, - HD1684 bioA, - HD1685 arcB, - HD1677 HD1675 bioD, - HD1680 HD1682 bioD, - HD1680 HD1682 arcB, - HD1674 HD1679 HD1675 oppF, - HD1672 yfcB, - HD1686 oppD, - HD1671
* Calculated from Protein Sequence

Gene ID: HD1680

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
bioD  

Definition:
dethiobiotin synthase

Gene Start:
1400589

Gene Stop:
1399954

Gene Length:
636

Molecular Weight*:
23665

pI*:
6.50

Net Charge*:
-1.75

EC:
6.3.3.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Sakurai N, Akatsuka H, Kawai E, Imai Y, Komatsubara S.
Complete sequence and organization of the Serratia marcescens biotin operon.
Microbiology. 1996 Nov;142 ( Pt 11):3295-303.
PMID: 8969526

Bower S, Perkins JB, Yocum RR, Howitt CL, Rahaim P, Pero J.
Cloning, sequencing, and characterization of the Bacillus subtilis biotin biosynthetic operon.
J Bacteriol. 1996 Jul;178(14):4122-30.
PMID: 8763940

Comment:
For other biotin-related genes, see HD0634, HD0635, HD1007, HD1394, HD1480, HD0082, HD1681.

See HD1480 for a paralog.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to dethiobiotin synthase protein; e.g. residues 1-186 are 65% similar to (U32830) dethiobiotin synthase of Haemophilus influenzae, residues 1-206 are 48% similar to (AE002428) dethiobiotin synthase of Neisseria meningitidis, residues 6-196 are 36% similar to (M29292) dethiobiotin synthase of Bacillus sphaericus.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0132
COG name: Dethiobiotin synthetase
Functional Class:  H
The phylogenetic pattern of COG0132 is -m--yq-cEbrHuj-----n-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-184 are 66% similar to a (DETHIOBIOTIN SYNTHETASE DTBS SYNTHASE) protein domain (PD003986) which is seen in Q9CJT7_PASMU.



Paralogs:  Local Blast Search


HD1680 is paralogously related to HD1480 (5e-14).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1DTS| Dethiobiotin Synthase (E.C.6.3.3.3) 97 2e-021
pdb|1BYI| Structure Of Apo-Dethiobiotin Synthase At 0.97 Ang... 95 8e-021

Gene Protein Sequence:
MGKIIFVSGIDTDIGKTIATGFYAKRLMQQGFSVITQKMIQTGCQHISAD
IIKHRQLQGIELTAEDLNGITCPYLFRYPCSPHLAAEMENNPILPSKIAQ
ASALLAQKYDYVLLEGAGGLAVPYNSQQTTLDYIVEQQLPLILVTSAKLG
SINHTLLSLIVCQQHKIEMEAVIYNTYPLEDEKIAKSTQLYLQQYIKQHF
PNTEFLVMDRQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTAAAATAATTTTTGTTTCAGGTATTGATACTGATATTGGTAAGAC
TATTGCGACAGGTTTTTATGCCAAAAGATTGATGCAACAAGGCTTTTCCG
TTATTACGCAAAAAATGATTCAAACCGGTTGTCAACACATCTCGGCAGAT
ATTATTAAACACCGTCAGCTACAAGGGATTGAACTAACGGCAGAAGATTT
AAATGGCATAACTTGTCCATATTTATTCCGTTACCCTTGTTCGCCACATT
TGGCGGCTGAAATGGAAAATAATCCAATACTTCCATCAAAAATTGCACAA
GCCAGTGCGTTATTAGCGCAAAAATATGACTATGTATTATTAGAAGGGGC
AGGTGGTTTGGCGGTTCCTTATAATTCACAGCAAACAACATTAGATTATA
TCGTTGAACAACAATTACCGTTGATTTTAGTGACTTCCGCTAAGTTGGGC
TCGATTAATCATACTTTATTAAGTTTAATAGTTTGTCAGCAACATAAAAT
TGAAATGGAAGCGGTTATTTATAATACTTATCCACTAGAAGATGAAAAAA
TAGCCAAGAGTACGCAGTTATATTTACAGCAATATATTAAACAACATTTC
CCTAATACCGAATTTTTAGTAATGGATAGACAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy