Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1225 IGR1228 IGR1223 IGR1226 IGR1227 IGR1224 arcB, - HD1674 HD1679 bioC, - HD1681 HD1678 bioF, - HD1684 arcB, - HD1677 oppF, - HD1672 dppB,yliC, - HD1670 oppD, - HD1671 arcB, - HD1674 HD1679 bioC, - HD1681 HD1678 bioF, - HD1684 arcB, - HD1677 oppF, - HD1672 dppB,yliC, - HD1670 oppD, - HD1671 bioC, - HD1681 HD1678 bioF, - HD1684 arcB, - HD1677 HD1675 bioD, - HD1680 HD1682 bioD, - HD1680 HD1682 arcB, - HD1674 HD1679 HD1675 oppF, - HD1672 dppB,yliC, - HD1670 oppD, - HD1671
* Calculated from Protein Sequence

Gene ID: HD1677

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
arcB  

Definition:
aerobic respiration sensor-response protein

Gene Start:
1398339

Gene Stop:
1396927

Gene Length:
1413

Molecular Weight*:
52967

pI*:
7.00

Net Charge*:
0.00

EC:
2.7.3.-  

Functional Class:
Regulatory functions  

Pathway: pathway table

Secondary Evidence:
Iuchi,S., Matsuda,Z., Fujiwara,T. and Lin,E.C.
The arcB gene of Escherichia coli encodes a sensor-regulator
protein for anaerobic repression of the arc modulon
Mol. Microbiol. 4 (5), 715-727 (1990)
MEDLINE: 90355832

Georgellis,D., Kwon,O., De Wulf,P. and Lin,E.C.
Signal decay through a reverse phosphorelay in the Arc
two-component signal transduction system
J. Biol. Chem. 273 (49), 32864-32869 (1998)
MEDLINE: 99047671

Kwon,O., Georgellis,D. and Lin,E.C.
Phosphorelay as the sole physiological route of signal transmission by the arc two-component system of Escherichia coli
J. Bacteriol. 182 (13), 3858-3862 (2000)
MEDLINE: 20309722

Kato,M., Mizuno,T., Shimizu,T. and Hakoshima,T.
Insights into multistep phosphorelay from the crystal structure of
the C-terminal HPt domain of ArcB
Cell 88 (5), 717-723 (1997)
MEDLINE: 97207018

Kato,M., Mizuno,T. and Hakoshima,T.
Crystallization of a complex between a novel C-terminal
transmitter, HPt domain, of the anaerobic sensor kinase ArcB and
the chemotaxis response regulator CheY
Acta Crystallogr. D 54, 140-142 (1998)

Kato,M., Mizuno,T., Shimizu,T. and Hakoshima,T.
Refined structure of the histidine-containing-phosphotransfer (HPt) domain of the anaerobic sensor kinase ArcB from Escherichia coli at 1.57-A resolution
Acta Crystallogr. D 55, 1842-1849 (1999)

Comment:
Should not be confused with arcB designating an OTCase.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to aerobic respiration control sensor protein; e.g. residues 27-461 are 52% similar to (AF227964) aerobic respiration control sensor protein of Haemophilus influenzae, residues 86-461 are 51% similar to (AE000400) aerobic respiration sensor-response protein; histidine protein kinase/phosphatase of Escherichia coli, residues 66-460 are 33% similar to (D90910) sensory transduction histidine kinase of Synechocystis sp.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0642
COG name: Sensory transduction histidine kinases
Functional Class:  T
The phylogenetic pattern of COG0642 is AMT-YQVCEBRHUJ--O-inX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** PR00344 (Bacterial sensor protein C-terminal signature) with a combined E-value of 2.4e-15.
    PR00344A    252-266
    PR00344B    270-280
    PR00344C    287-305
    PR00344D    311-324
***** IPB003661 (His Kinase A domain) with a combined E-value of 5.9e-13.
    IPB003661A    110-119
    IPB003661B    225-234
    IPB003661C    256-264
***** IPB001294 (Phytochrome) with a combined E-value of 5e-12.
    IPB001294K    88-139
    IPB001294L    289-320
***** IPB001789 (Response regulator receiver domain) with a combined E-value of 5.2e-09.
    IPB001789B    386-399
    IPB001789C    439-448
***** IPB001867 (Transcriptional regulatory protein, C terminal) with a combined E-value of 9.8e-08.
    IPB001867A    386-399
    IPB001867B    419-463


ProDom Summary:  Protein Domain Search
Residues 343-453 are 66% similar to a (SENSORY TRANSDUCTION PHOSPHORYLATION REGULATOR) protein domain (PD000039) which is seen in Q9CNW0_PASMU.

Residues 218-272 are 60% similar to a (KINASE SENSORY TRANSDUCTION PHOSPHORYLATION TRANSFERASE) protein domain (PD371767) which is seen in Q9CNW0_PASMU.

Residues 96-178 are 74% similar to a (KINASE SENSORY TRANSDUCTION PHOSPHORYLATION TRANSFERASE) protein domain (PD000142) which is seen in ARCB_HAEIN.

Residues 27-82 are 51% similar to a (KINASE SENSORY PHOSPHORYLATION) protein domain (PD031140) which is seen in Q9CNW0_PASMU.



Paralogs:  Local Blast Search
HD1677 is paralogously related to HD1470 (5e-11), HD1469 (6e-09) and HD0278 (3e-05).


Pfam Summary:  Pfam Search
Residues 102 to 167 (E-value = 3.6e-21) place HD1677 in the HisKA family which is described as His Kinase A (phosphoacceptor) domain (PF00512)
Residues 214 to 326 (E-value = 1.6e-39) place HD1677 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 341 to 464 (E-value = 1.7e-25) place HD1677 in the Response_reg family which is described as Response regulator receiver domain (PF00072)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VLRLGRGKAALLGVFVLVLAFYALIIQSALTYLFTREIKAQDILRSISFG
LVSAPFVIYFFNLIVEKLEKSRIQLEKSVYDLGILREQDARLNAMLEKNS
RDKTVLMATISHELRTPLNGIIGLSRILLESELNAQQREYLKTINISAVS
LGHIFSDIIDLEKIDSRRIELFKKEVEFSQLISDISHFGHLMAAQRQIHF
HICYADDLPNFIYIDNARLSQILWNLVSNAVKFTPAGGDVYLTVKRLDKD
HFSFSLRDTGIGIPTKEQRKVFALFYQAENAQAKKAQGSGIGLAVSKRIA
KLMGGDLTLESEEGKGSTFVLTIQAEPVKARKAVEIMAHSLRVLLVEDIE
VNVIVARTMLEKFGCQVDVAMSGADALAQFAEQTYDLILLDIQLPDMSGF
DIAQTLRQRYQNEQLDYLPLLIALTANVMQTKQEYQQQGMDDVLRKPLSL
EALAECLNHYFGGRFYAKFS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTACGTCTAGGGCGTGGTAAAGCCGCATTACTTGGTGTGTTTGTGCT
TGTGCTTGCATTTTATGCATTGATTATACAAAGTGCCTTGACCTATCTAT
TTACCCGCGAAATTAAAGCACAAGATATTTTGCGTTCAATTTCATTTGGT
TTAGTTTCAGCACCTTTTGTGATTTATTTTTTCAATTTAATTGTAGAAAA
ACTAGAGAAATCAAGAATTCAATTAGAAAAAAGTGTTTATGATTTAGGCA
TTTTACGTGAACAAGATGCTCGTTTAAATGCGATGCTTGAGAAAAATAGC
CGTGATAAAACCGTATTAATGGCAACCATTAGCCACGAGTTACGTACGCC
TCTCAATGGTATTATTGGACTTAGTCGGATTTTATTAGAAAGTGAATTAA
ATGCACAACAGCGTGAATATTTAAAAACTATTAACATTAGCGCCGTTTCT
CTGGGGCATATTTTTAGCGATATTATTGACTTGGAAAAAATTGATAGCCG
TCGTATCGAGCTTTTTAAAAAAGAAGTGGAGTTTTCGCAACTGATCAGCG
ATATCAGCCATTTCGGGCATTTAATGGCAGCACAACGACAGATTCACTTT
CATATTTGTTATGCAGATGATTTACCAAATTTTATCTATATAGATAATGC
ACGTTTGAGCCAAATTTTATGGAATTTGGTTAGCAATGCGGTCAAATTTA
CGCCCGCAGGTGGAGATGTTTATTTAACGGTTAAGCGATTAGATAAAGAT
CACTTTAGCTTTAGTCTGAGAGATACGGGGATTGGTATTCCAACCAAAGA
ACAACGAAAAGTATTTGCTCTGTTTTATCAAGCTGAAAACGCACAGGCGA
AAAAAGCACAAGGGAGTGGCATCGGCTTAGCCGTCTCTAAGCGGATAGCC
AAATTAATGGGCGGTGATCTAACCCTAGAAAGTGAAGAAGGTAAAGGCTC
TACCTTTGTGTTGACTATTCAAGCCGAGCCCGTTAAAGCACGGAAAGCGG
TTGAAATTATGGCACATTCGTTACGAGTATTATTGGTGGAAGATATTGAA
GTTAATGTGATTGTAGCACGTACGATGCTTGAGAAGTTTGGCTGTCAGGT
TGATGTGGCAATGAGCGGCGCTGATGCATTAGCCCAATTTGCAGAACAAA
CCTACGATCTAATTTTGTTAGATATTCAATTACCTGATATGAGTGGCTTT
GATATTGCACAAACATTACGGCAACGTTATCAAAATGAACAACTTGATTA
TTTACCATTATTAATTGCATTAACAGCAAATGTTATGCAAACGAAGCAAG
AATATCAGCAACAAGGTATGGATGATGTTTTGCGTAAACCTTTATCGTTA
GAAGCATTGGCGGAATGTTTAAATCATTATTTTGGTGGCCGATTTTATGC
AAAATTCAGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy