Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1219 IGR1220 IGR1218 IGR1222 IGR1221 IGR1217 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntA, - HD1663 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669 oppD, - HD1671 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntA, - HD1663 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669 oppD, - HD1671 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntA, - HD1663 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669 oppD, - HD1671
* Calculated from Protein Sequence

Gene ID: HD1668

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hemN  

Definition:
oxygen-independent coproporphyrinogen III oxidase

Gene Start:
1390523

Gene Stop:
1389339

Gene Length:
1185

Molecular Weight*:
45113

pI*:
6.70

Net Charge*:
-2.75

EC:
1.3.3.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Layer G, Verfurth K, Mahlitz E, Jahn D.
Oxygen-independent Coproporphyrinogen-III Oxidase HemN from Escherichia coli.
J Biol Chem. 2002 Sep 13;277(37):34136-42.
PMID: 12114526

Homuth G, Rompf A, Schumann W, Jahn D.
Transcriptional control of Bacillus subtilis hemN and hemZ.
J Bacteriol. 1999 Oct;181(19):5922-9.
PMID: 10498703

Lieb C, Siddiqui RA, Hippler B, Jahn D, Friedrich B.
The Alcaligenes eutrophus hemN gene encoding the oxygen-independent coproporphyrinogen III oxidase, is required for heme biosynthesis during anaerobic growth.
Arch Microbiol. 1998 Jan;169(1):52-60.
PMID: 9396835

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to coproporphyrinogen III oxidase protein; e.g. residues 9-394 are 72% similar to (U32729) oxygen-independent coproporphyrinogen III oxidase, putative of Haemophilus influenzae, residues 9-393 are 62% similar to (AE000378) putative oxidase of Escherichia coli, residues 9-393 are 46% similar to (AL162754) putative porphyrin oxidoreductase of Neisseria meningitidis.


COGS Summary:  COGS Search
BeTs to 11 clades of COG0635
COG name: Coproporphyrinogen III oxidase and related FeS oxidoreductases
Functional Class: H
The phylogenetic pattern of COG0635 is -----QvCEBrhUJ--olINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003401 (Oxygen-independent coproporphyrinogen III oxidase) with a combined E-value of 4.1e-31.
    IPB003401B    13-28
    IPB003401C    68-81
    IPB003401D    104-149
    IPB003401E    173-217


ProDom Summary:  Protein Domain Search
Residues 21-232 are 55% similar to a (PROTEOME COMPLETE OXIDASE III COPROPORPHYRINOGEN) protein domain (PD000690) which is seen in Q9I6A9_PSEAE.

Residues 132-209 are 65% similar to a (COMPLETE OXIDASE PROTEOME III) protein domain (PD342340) which is seen in Q9CKF2_PASMU.

Residues 252-340 are 49% similar to a (OXIDASE III PROTEOME COMPLETE) protein domain (PD009540) which is seen in Q9I6A9_PSEAE.

Residues 13-52 are 82% similar to a (PROTEOME COMPLETE III OXIDASE) protein domain (PD332371) which is seen in Q9KUR0_VIBCH.

Residues 63-131 are 68% similar to a (III PROTEOME COMPLETE COPROPORPHYRINOGEN) protein domain (PD354252) which is seen in Q9CKF2_PASMU.

Residues 341-393 are 52% similar to a (OXIDOREDUCTASE PROTEOME BIOSYNTHESIS) protein domain (PD034447) which is seen in Q9KUR0_VIBCH.

Residues 287-340 are 64% similar to a (COMPLETE PROTEOME OXIDOREDUCTASE) protein domain (PD202576) which is seen in YGGW_HAEIN.

Residues 210-250 are 85% similar to a (COMPLETE PROTEOME III XF1507) protein domain (PD202567) which is seen in Q9CKF2_PASMU.

Residues 66-127 are 67% similar to a (PROTEOME OXIDASE COMPLETE III) protein domain (PD395779) which is seen in Q9KUR0_VIBCH.



Paralogs:  Local Blast Search
HD1668 is paralogously related to HD0037 (6e-21).


Pfam Summary:  Pfam Search
Residues 15 to 197 (E-value = 1.5e-20) place HD1668 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 269 to 383 (E-value = 7e-19) place HD1668 in the HemN_C family which is described as HemN C-terminal region (PF06969)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LANHVSLILPPLSLYIHIPWCVQKCPYCDFNSHTQKGTIPEAEYIQHLLA
DLSQDLVTYKTAIANRKIHSIFIGGGTPSLFSAEAIAYLLAEIKQRIAFA
PKIEITLEANPGTAEAERFICYTEAGINRISMGIQSFEEEKLRKLGRIHD
AHEAKQAVYFAKNALISPSRTVGLHSFNLDLMHGLPNQTLEQALADLNTA
ISLNPPHFSWYQLTIEPNTMFYYRQPTLPDDDELWAIFEQGHQLLTMAGY
QQYETSAYAKQGFQCQHNLNYWRFGDYLAIGCGAHGKISYPSGEIYRFSK
TKHPKGYMRGDYRDSQQSIQLDDRPFEFFMNRFRLLEPTPKQEFECYTGL
DCERVRPTIDWALNKHYISETSTTWQVTQKGKLFLNELLAGFLT$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCAAATCACGTGAGTCTTATTCTTCCACCTTTAAGCCTTTATATTCA
TATCCCTTGGTGTGTGCAAAAATGCCCATACTGTGATTTTAATTCACATA
CACAGAAAGGAACCATTCCTGAAGCTGAATATATTCAACATTTATTAGCG
GATTTATCGCAAGATTTAGTCACTTATAAAACGGCTATCGCAAATCGTAA
AATTCATTCCATTTTTATTGGTGGAGGAACGCCTAGCCTTTTTTCAGCAG
AAGCAATAGCTTACTTATTAGCAGAAATTAAGCAACGGATTGCGTTTGCT
CCAAAAATTGAAATCACACTTGAAGCCAATCCCGGTACCGCAGAAGCGGA
GCGTTTTATTTGTTATACCGAAGCAGGGATTAACCGTATTTCAATGGGGA
TTCAAAGTTTTGAAGAGGAAAAATTACGCAAGTTGGGGCGTATTCACGAT
GCTCATGAAGCTAAACAAGCGGTCTATTTTGCCAAAAATGCACTTATTTC
GCCATCAAGAACAGTAGGGTTACACAGTTTTAACCTTGATTTAATGCACG
GGTTGCCAAACCAAACGCTTGAACAAGCATTAGCGGATTTAAATACGGCT
ATTTCGCTTAATCCACCGCATTTTTCTTGGTATCAATTGACTATTGAACC
GAATACAATGTTCTATTATCGTCAACCGACGTTACCTGATGATGATGAAC
TATGGGCTATTTTTGAACAAGGCCATCAGTTATTGACTATGGCGGGTTAT
CAACAGTATGAAACTTCTGCTTATGCTAAGCAAGGATTCCAATGCCAACA
TAATTTAAATTATTGGCGATTTGGTGATTATTTAGCCATTGGATGTGGTG
CTCACGGGAAAATTTCTTACCCAAGCGGTGAAATTTATCGATTCAGTAAA
ACCAAACATCCTAAAGGCTATATGCGCGGTGATTATCGCGATAGCCAACA
ATCGATTCAACTTGATGATCGTCCCTTTGAGTTTTTTATGAACCGCTTTC
GTTTACTTGAGCCAACACCAAAGCAAGAATTTGAATGCTATACTGGATTA
GATTGTGAAAGGGTAAGGCCAACGATTGATTGGGCATTAAATAAGCATTA
TATTTCAGAAACTAGCACAACTTGGCAAGTTACACAAAAAGGCAAACTGT
TCTTAAACGAGCTATTAGCAGGCTTTTTGACATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy