Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1219 IGR1216 IGR1220 IGR1218 IGR1222 IGR1221 IGR1217 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntB, - HD1662 pntA, - HD1663 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669 oppD, - HD1671 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntB, - HD1662 pntA, - HD1663 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669 oppD, - HD1671 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntB, - HD1662 pntA, - HD1663 spoU, - HD1664 dppA, - HD1669 oppD, - HD1671 dppB,yliC, - HD1670
* Calculated from Protein Sequence

Gene ID: HD1666

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
probable phosphatase

Gene Start:
1388797

Gene Stop:
1388249

Gene Length:
549

Molecular Weight*:
20417

pI*:
4.70

Net Charge*:
-7.42

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few significant hits in gapped BLAST to conserved hypothetical protein; i.e. residues 4-177 are 71% similar to (U32744) conserved hypothetical protein of Haemophilus influenzae, residues 5-177 are 65% similar to (AE000129) putative phosphatase of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0241
COG name: Histidinol phosphatase and related phosphatases
Functional Class: E
The phylogenetic pattern of COG0241 is -m-----cE-rHuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-55 are 79% similar to a (PROTEOME COMPLETE BIOSYNTHESIS HISTIDINE) protein domain (PD007272) which is seen in Q9CK98_PASMU.

Residues 56-135 are 77% similar to a (BIOSYNTHESIS HISTIDINE PROTEOME COMPLETE) protein domain (PD007329) which is seen in Q9CK98_PASMU.



Paralogs:  Local Blast Search

HD1666 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGKKAVFLDRDGTLNIDHGYVHQIDDFQFIEGVGKALKQLQDKGYLLVLV
TNQSGIARGYFSEQQFQQLTEWMDWSLDEDYGVVLDGIYYCPHYPEGQGE
YQQKCDCRKPKAGMFQQAIKDLNIDPAQSYMVGDKLEDLLAAETAGVKTK
VLVRTGKAITAEGEKKADLVLNSLVDLVPYVN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGAAAAAAAGCGGTTTTTTTAGATCGTGATGGTACCTTGAATATTGA
TCATGGTTATGTTCATCAAATTGATGATTTTCAATTTATTGAAGGCGTTG
GTAAAGCATTGAAACAATTACAAGATAAAGGTTATTTGTTAGTGTTAGTC
ACTAATCAATCTGGTATTGCGCGTGGTTATTTTAGTGAGCAACAATTTCA
GCAATTAACAGAATGGATGGATTGGTCGTTAGATGAAGACTATGGGGTTG
TGTTGGACGGTATTTATTATTGTCCACATTACCCAGAAGGTCAGGGCGAG
TATCAGCAGAAATGTGATTGTCGTAAACCAAAAGCCGGTATGTTTCAGCA
AGCGATTAAAGATTTAAACATTGATCCCGCTCAGTCTTATATGGTCGGCG
ATAAATTGGAAGATTTATTAGCTGCAGAAACCGCAGGCGTAAAAACGAAA
GTCCTTGTGCGAACAGGTAAGGCAATTACCGCAGAGGGTGAAAAAAAAGC
AGATTTAGTACTAAATAGTTTGGTTGATTTAGTACCTTACGTAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy