Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1219 IGR1216 IGR1220 IGR1215 IGR1218 IGR1222 IGR1221 IGR1217 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 spoU, - HD1664 dppB,yliC, - HD1670 dppA, - HD1669
* Calculated from Protein Sequence

Gene ID: HD1665

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1388236

Gene Stop:
1387397

Gene Length:
840

Molecular Weight*:
32307

pI*:
4.90

Net Charge*:
-13.33

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few significant hits in gapped BLAST to conserved hypothetical protein; i.e. residues 1-279 are 65% similar to (U32809) conserved hypothetical protein of Haemophilus influenzae, residues 8-279 are 61% similar to (AE000363) hypothetical protein of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0780
COG name: Uncharacterized BCR, YkvM family
Functional Class: S
The phylogenetic pattern of COG0780 is -----qvceb-Huj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 13-182 are 61% similar to a (PROTEOME COMPLETE HI1291 XF2383) protein domain (PD022592) which is seen in Q9CNF6_PASMU.

Residues 185-249 are 83% similar to a (COMPLETE PROTEOME I BH2241) protein domain (PD010789) which is seen in YQCD_HAEIN.



Paralogs:  Local Blast Search
HD1665 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 176 to 271 (E-value = 5e-09) place HD1665 in the GTP_cyclohydroI family which is described as GTP cyclohydrolase I (PF01227)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSYTDTVLSSLKLGQKTEYTGEYDPTLLQAVPRKLNRDHLGITEQQPFNQ
GADVWTCYEVSWLNLNGLPQVAIAEVVIDANSENLIESKSFKLYLNSVNQ
TTFESLEQVEYIIESDLSRCACGLVWVKIHKLSEYKNEIIADFSGECIDE
QDIEIDNYQYSAQYLEHSAEGEEVEETLVSHLLKSNCLITSQPDWGSVQI
HYVGKKINREKLLRYLVSFREHNEFHEQCVERIFTDLMTFAKPEKLMVYA
RYTRRGGLEINPFRANFDAMPQHIRMARQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTACACTGATACAGTATTATCATCTCTTAAATTAGGGCAAAAAAC
AGAATACACGGGGGAATACGATCCTACGTTATTACAAGCCGTACCACGTA
AATTAAATCGTGATCATTTAGGGATAACAGAACAACAACCTTTTAACCAA
GGTGCAGATGTTTGGACGTGTTATGAAGTTTCTTGGTTGAATTTAAATGG
TTTACCTCAAGTGGCTATTGCAGAAGTGGTCATTGATGCAAATAGCGAAA
ATTTGATTGAATCAAAAAGTTTTAAGCTTTACTTAAATAGTGTTAACCAA
ACTACATTTGAATCATTAGAGCAAGTGGAATATATCATTGAATCTGATTT
AAGTCGCTGTGCTTGCGGGCTAGTTTGGGTAAAAATTCACAAATTATCTG
AATATAAGAATGAAATTATTGCTGATTTCAGTGGTGAATGTATTGATGAA
CAAGATATCGAAATTGATAACTACCAATATTCAGCGCAGTATTTAGAGCA
TTCAGCAGAAGGTGAAGAGGTTGAAGAAACACTTGTTAGCCATCTACTCA
AGTCGAATTGTTTAATTACGTCACAACCTGATTGGGGCAGTGTGCAAATC
CATTATGTGGGTAAAAAAATCAATCGTGAAAAATTATTACGTTATTTAGT
GTCATTCCGTGAGCATAATGAGTTCCATGAACAATGTGTTGAACGCATTT
TCACAGATTTAATGACGTTTGCTAAACCAGAAAAATTAATGGTGTATGCA
CGTTATACGCGCAGAGGTGGTTTAGAGATTAACCCGTTCCGTGCAAATTT
TGATGCAATGCCACAACATATAAGAATGGCTAGACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy