Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1214 IGR1219 IGR1216 IGR1220 IGR1215 IGR1218 IGR1212 IGR1213 IGR1221 IGR1217 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 bcp, - HD1667 HD1666 HD1665 hemN, - HD1668 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664
* Calculated from Protein Sequence

Gene ID: HD1663

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pntA  

Definition:
NAD(P) transhydrogenase alpha subunit

Gene Start:
1386302

Gene Stop:
1384767

Gene Length:
1536

Molecular Weight*:
54252

pI*:
8.70

Net Charge*:
3.60

EC:
1.6.1.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Nicotinate and nicotinamide metabolism

Secondary Evidence:
Anderlund M, Nissen TL, Nielsen J, Villadsen J, Rydstrom J, Hahn-Hagerdal B, Kielland-Brandt MC.
Expression of the Escherichia coli pntA and pntB genes, encoding nicotinamide nucleotide transhydrogenase, in Saccharomyces cerevisiae and its effect on
product formation during anaerobic glucose fermentation.
Appl Environ Microbiol. 1999 Jun;65(6):2333-40.
PMID: 10347010

Clarke DM, Loo TW, Gillam S, Bragg PD.
Nucleotide sequence of the pntA and pntB genes encoding the pyridine nucleotide transhydrogenase of Escherichia coli.
Eur J Biochem. 1986 Aug 1;158(3):647-53.
PMID: 3525165

Comment:
0

Blast Summary:  PSI-Blast Search
numerous significant hits in gapped BLAST to NAD(P) transhydrogenase alpha subunit protein; e.g. residues 1-511 are 77% similar to U32816) NAD(P) transhydrogenase, subunit alpha of Haemophilus influenzae, residues 1-510 are 67% similar to NAD(P)+ transhydrogenase (B-specific) of Escherichia coli, residues 1-511 are 65% similar to (AL162755) putative NAD(P) transhydrogenase alpha subunit of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0686
COG name: NAD/NADP transhydrogenase alpha subunit
Functional Class:  C
The phylogenetic pattern of COG0686 is ----y--CebRhuj------X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB004002 (Alanine dehydrogenase and pyridine nucleotide transhydrogenase) with a combined E-value of 6.3e-89.
    IPB004002A    1-40
    IPB004002B    157-209
    IPB004002C    258-293


ProDom Summary:  Protein Domain Search
Residues 258-297 are 92% similar to a (TRANSHYDROGENASE NADP NUCLEOTIDE SUBUNIT ALPHA PYRIDINE) protein domain (PD414502) which is seen in PNTA_HAEIN.

Residues 423-509 are 91% similar to a (TRANSHYDROGENASE NADP NUCLEOTIDE SUBUNIT ALPHA PYRIDINE) protein domain (PD004836) which is seen in PNTA_HAEIN.

Residues 258-296 are 74% similar to a (DEHYDROGENASE ALANINE OXIDOREDUCTASE) protein domain (PD410567) which is seen in Q9P712_NEUCR.

Residues 1-141 are 76% similar to a (TRANSHYDROGENASE OXIDOREDUCTASE NADP DEHYDROGENASE) protein domain (PD002205) which is seen in Q9CMQ9_PASMU.

Residues 298-368 are 76% similar to a (TRANSHYDROGENASE NADP NUCLEOTIDE SUBUNIT ALPHA PYRIDINE) protein domain (PD005311) which is seen in PNTA_ECOLI.

Residues 149-256 are 69% similar to a (TRANSHYDROGENASE NADP NUCLEOTIDE SUBUNIT ALPHA PYRIDINE) protein domain (PD410015) which is seen in PNTA_HAEIN.



Paralogs:  Local Blast Search


HD1663 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 137 (E-value = 2.3e-73) place HD1663 in the AlaDh_PNT_N family which is described as Alanine dehydrogenase/PNT, N-terminal domain (PF05222)
Residues 144 to 350 (E-value = 1.2e-104) place HD1663 in the AlaDh_PNT_C family which is described as Alanine dehydrogenase/PNT, C-terminal domain (PF01262)

PDB Hit:
pdb|1PJC|A Chain A, L-Alanine Dehydrogenase Complexed With Nad ... 102 8e-023

Gene Protein Sequence:
MLIGIPKELLNGETRVAATPKTVEQIKKLGFDVIVERGAGVKASFEDEAF
VNAGANIGTQKKVWKANIIFKVNAPTDAEIALMNEGTTLVSFIWPAQNAE
LMQKLTAKKINVLAMDAVPRISRAQALDALSSMANISGYRAVIEAANVFG
SFFTGQITAAGKVPPAKVLVIGAGVAGLAAIGAANSLGAIVRAFDSRPEV
KEQVKSMGAEFLAIDFEEDAGSGDGYAKVMSEEFNRRSMELYAEQAKDVD
IIITTAAIPGKPAPRLITKEMVDSMKPGSVVVDLAAATGGNCDYTKAGEV
VITDNQVKVIGYTDFPARLPTQSSQLYGTNLVNLLKLLTPNKDGQIAINF
DDVVVRGVTVIRDGEVTWPAPPIQVSAQPQKPTVTPITPKVDKPARPGVK
YSIIGGVIALFFWIASIAPAAFLSHFTVFMLACVVGYYVVWNVSHALHTP
LMAVTNAISGIIIVGAVLQIAQPTGNLFIDLLASCAILVASINIFGGFKV
TQRMLAMFRKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTATTGGTATACCAAAAGAGCTTTTAAACGGTGAAACTCGTGTGGC
GGCAACGCCTAAGACCGTTGAGCAAATTAAAAAACTTGGCTTTGATGTTA
TTGTAGAACGTGGTGCCGGCGTTAAGGCGAGTTTTGAAGATGAGGCTTTT
GTTAATGCAGGTGCAAATATCGGCACCCAAAAAAAAGTGTGGAAAGCCAA
TATTATTTTTAAAGTAAATGCGCCAACCGATGCTGAAATTGCATTAATGA
ACGAGGGCACAACATTAGTCAGCTTTATTTGGCCCGCACAAAATGCAGAA
TTAATGCAAAAATTGACCGCTAAGAAAATTAATGTATTAGCGATGGACGC
AGTCCCACGTATTTCTCGTGCTCAGGCGCTTGATGCGTTAAGCTCAATGG
CAAATATTTCAGGTTACCGAGCAGTAATTGAAGCGGCAAATGTTTTTGGT
AGCTTCTTTACAGGGCAAATTACCGCTGCTGGTAAAGTGCCACCCGCAAA
AGTGTTAGTGATTGGTGCGGGTGTTGCGGGATTAGCTGCCATTGGTGCGG
CAAATAGCCTTGGTGCAATTGTACGAGCCTTTGATTCACGTCCAGAAGTA
AAAGAACAAGTTAAATCAATGGGCGCTGAATTTTTAGCCATTGATTTTGA
AGAGGACGCCGGATCAGGTGATGGTTATGCGAAGGTTATGTCGGAAGAAT
TTAACCGTCGTTCGATGGAGCTCTATGCTGAGCAAGCAAAAGACGTGGAT
ATTATCATTACAACTGCGGCTATTCCGGGTAAGCCCGCGCCACGTTTGAT
CACTAAAGAAATGGTAGATTCAATGAAGCCTGGTTCTGTTGTGGTCGATT
TAGCCGCGGCAACCGGTGGTAATTGTGATTATACTAAAGCCGGAGAAGTG
GTTATCACTGATAATCAAGTGAAAGTGATTGGTTATACTGATTTTCCTGC
CCGTTTGCCGACACAATCTTCCCAGCTTTATGGCACTAATTTAGTTAATT
TATTAAAACTATTAACGCCGAATAAAGATGGTCAAATTGCGATTAATTTT
GATGATGTTGTTGTGCGTGGAGTAACGGTTATTCGTGATGGTGAAGTGAC
TTGGCCCGCACCACCTATTCAAGTATCAGCACAACCACAAAAGCCAACAG
TAACGCCGATTACGCCTAAAGTAGATAAGCCTGCAAGGCCTGGCGTTAAA
TATAGTATTATCGGTGGCGTAATTGCACTATTTTTCTGGATAGCCTCTAT
TGCACCTGCTGCATTTTTATCCCACTTTACGGTTTTCATGTTAGCGTGTG
TAGTGGGTTATTATGTTGTTTGGAATGTAAGCCACGCCTTGCATACGCCA
TTAATGGCCGTTACTAATGCTATTTCAGGCATTATTATTGTTGGCGCGGT
GCTACAAATTGCACAGCCAACCGGTAACTTATTTATTGATTTGTTGGCAT
CCTGTGCAATTTTAGTCGCTAGTATCAATATTTTTGGTGGCTTTAAAGTG
ACTCAACGTATGTTGGCAATGTTTAGAAAAGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy