Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1214 IGR1219 IGR1216 IGR1210 IGR1211 IGR1215 IGR1218 IGR1212 IGR1213 IGR1217 HD1656 HD1657 bcp, - HD1667 HD1666 HD1665 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 HD1656 HD1657 bcp, - HD1667 HD1666 HD1665 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 HD1657 HD1666 HD1665 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1656 bcp, - HD1667 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664
* Calculated from Protein Sequence

Gene ID: HD1662

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pntB  

Definition:
NAD(P) transhydrogenase, subunit beta

Gene Start:
1384754

Gene Stop:
1383306

Gene Length:
1449

Molecular Weight*:
51201

pI*:
5.60

Net Charge*:
-7.72

EC:
1.6.1.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Nicotinate and nicotinamide metabolism

Secondary Evidence:
Anderlund M, Nissen TL, Nielsen J, Villadsen J, Rydstrom J, Hahn-Hagerdal B, Kielland-Brandt MC.
Expression of the Escherichia coli pntA and pntB genes, encoding nicotinamide nucleotide transhydrogenase, in Saccharomyces cerevisiae and its effect on
product formation during anaerobic glucose fermentation.
Appl Environ Microbiol. 1999 Jun;65(6):2333-40.
PMID: 10347010

Clarke DM, Loo TW, Gillam S, Bragg PD.
Nucleotide sequence of the pntA and pntB genes encoding the pyridine nucleotide transhydrogenase of Escherichia coli.
Eur J Biochem. 1986 Aug 1;158(3):647-53.
PMID: 3525165

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to NAD(P) transhydrogenase, subunit beta protein; e.g. residues 1-481 are 82% similar to NAD(P) transhydrogenase, subunit beta of Haemophilus influenzae, residues 1-481 are 74% similar to (X04195) NAD(P) transhydrogenase subunit beta of Escherichia coli, residues 1-481 are 72% similar to (AL162755) putative NAD(P) transhydrogenase beta subunit of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1282
COG name: NAD(P)+ transhydrogenase, beta subunit
Functional Class:  C
The phylogenetic pattern of COG1282 is -------ce-rh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB004003 (NAD(P) transhydrogenase beta subunit) with a combined E-value of 0.
    IPB004003A    14-46
    IPB004003B    63-96
    IPB004003C    142-195
    IPB004003D    212-257
    IPB004003E    258-291
    IPB004003F    320-364
    IPB004003G    365-405
    IPB004003H    406-443
    IPB004003I    444-477
    IPB004003B    212-245
    IPB004003C    147-200
    IPB004003D    63-108


ProDom Summary:  Protein Domain Search
Residues 136-481 are 84% similar to a (TRANSHYDROGENASE NADP NUCLEOTIDE SUBUNIT BETA PYRIDINE) protein domain (PD005076) which is seen in PNTB_HAEIN.

Residues 60-103 are 86% similar to a (TRANSHYDROGENASE NADP NUCLEOTIDE BETA SUBUNIT PYRIDINE) protein domain (PD349602) which is seen in Q9CMR0_PASMU.

Residues 1-59 are 86% similar to a (TRANSHYDROGENASE SUBUNIT BETA NADP) protein domain (PD359919) which is seen in Q9CMR0_PASMU.



Paralogs:  Local Blast Search


HD1662 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1DJL|A Chain A, The Crystal Structure Of Human Transhydroge... 250 3e-067
pdb|1E3T|A Chain A, Solution Structure Of The Nadp(H) Binding C... 234 2e-062
pdb|1D4O|A Chain A, Crystal Structure Of Transhydrogenase Domai... 233 4e-062

Gene Protein Sequence:
MSLGFVTAAYIIAALLFIMSLAGLSKHETAKAGCWYGISGMAIALFATIF
GPQSYGTIWILIAMAIGGYIGIQKALKVEMTAMPELVAILHSFVGLAAVL
VGFNSYGLHNDPLIPSNLDAVARANFIVEQQTLATIHYIEVFLGIFIGAV
TFSGSLIAFGKLSGNLFGCKVSSVALNLPNKHKLNLAALIISGLLMMVFL
NNPVNIFPVLIMTIIALALGWHLVASIGGADMPVVVSMLNSYSGWAAAAA
GFMLSNDLLIVTGALVGSSGAILSYIMCKAMNRSFISVIAGGFGNEMKAD
SAAEQAQGEHRETTVEDVAEMLKNAHSVIITPGYGMAVAQAQYPVAEITA
KLREKGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEINDDFEN
TDVVLVIGANDTVNPAALDDPSSPIAGMPVLEVWKAQNVVVFKRSMAVGY
AGVQNPLFFKENTQMLFGDAKERVDDILRALN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTAGGATTTGTAACTGCGGCATATATTATTGCTGCTCTTCTTTT
TATTATGAGCTTAGCAGGGCTTTCTAAGCATGAAACTGCTAAGGCAGGTT
GTTGGTATGGTATTTCCGGAATGGCGATTGCCTTATTCGCAACAATTTTT
GGTCCACAATCTTATGGCACTATTTGGATCCTCATTGCTATGGCAATAGG
GGGCTATATTGGTATCCAGAAAGCCTTAAAAGTAGAAATGACAGCAATGC
CAGAGTTAGTGGCAATTTTACATAGTTTTGTTGGTTTAGCGGCAGTATTA
GTTGGCTTCAATAGTTATGGTTTACATAATGATCCGTTAATACCGTCGAA
TTTAGATGCGGTAGCACGAGCTAATTTCATCGTAGAGCAACAAACCTTAG
CTACTATTCATTATATTGAGGTATTTTTAGGTATTTTCATTGGTGCGGTC
ACTTTTTCTGGCTCATTGATTGCATTTGGTAAATTAAGCGGTAATTTATT
TGGATGTAAAGTATCCTCTGTTGCATTAAATTTACCTAATAAACACAAGC
TCAATTTAGCAGCATTAATTATTTCCGGCTTATTAATGATGGTGTTTTTG
AATAACCCGGTAAATATTTTCCCAGTGTTAATTATGACGATTATTGCACT
TGCGCTTGGTTGGCATTTAGTTGCATCAATTGGTGGAGCGGATATGCCTG
TCGTTGTTTCTATGTTGAATTCATATTCAGGATGGGCAGCTGCGGCAGCA
GGTTTTATGTTAAGTAATGATTTGCTTATCGTAACTGGTGCGTTAGTTGG
TTCATCTGGTGCAATTCTTTCTTATATTATGTGTAAGGCGATGAATCGTT
CATTTATTAGTGTTATTGCCGGTGGTTTTGGGAATGAAATGAAAGCTGAT
TCAGCAGCAGAACAAGCACAAGGCGAACACCGTGAAACAACGGTAGAAGA
TGTGGCAGAAATGTTGAAAAACGCACATTCTGTGATTATCACTCCCGGTT
ATGGAATGGCGGTTGCGCAGGCCCAGTATCCGGTCGCGGAAATCACCGCT
AAATTACGTGAAAAAGGCATTAATGTTCGTTTTGGTATTCATCCAGTCGC
GGGGCGATTACCAGGCCATATGAATGTATTGTTGGCGGAAGCGAAAGTGC
CTTATGATGTTGTTTTAGAAATGGATGAAATCAATGATGATTTTGAAAAT
ACAGACGTTGTATTGGTCATCGGTGCTAATGATACAGTGAATCCAGCTGC
GTTAGATGATCCATCAAGCCCAATTGCAGGAATGCCTGTGTTAGAAGTTT
GGAAAGCCCAAAATGTTGTGGTATTTAAACGTTCTATGGCAGTGGGTTAT
GCTGGCGTACAAAATCCATTGTTCTTTAAGGAAAATACCCAAATGTTATT
TGGTGATGCTAAAGAACGGGTAGATGATATTTTACGAGCATTAAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy