Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1214 IGR1216 IGR1209 IGR1210 IGR1211 IGR1215 IGR1218 IGR1212 IGR1213 IGR1217 HD1656 HD1657 HD1665 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 HD1656 HD1657 HD1665 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 HD1657 HD1665 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 HD1656 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664
* Calculated from Protein Sequence

Gene ID: HD1661

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dcd  

Definition:
deoxycytidine triphosphate deaminase

Gene Start:
1382599

Gene Stop:
1383183

Gene Length:
585

Molecular Weight*:
21434

pI*:
6.00

Net Charge*:
-3.60

EC:
3.5.4.13  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Krogan NJ, Zaharik ML, Neuhard J, Kelln RA.
A combination of three mutations, dcd, pyrH, and cdd, establishes thymidine (Deoxyuridine) auxotrophy in thyA+ strains of
Salmonella typhimurium.
J Bacteriol. 1998 Nov;180(22):5891-5.
PMID: 9811646

Koonin EV.
Pseudouridine synthases: four families of enzymes containing a putative uridine-binding motif also conserved in dUTPases and dCTP
deaminases.
Nucleic Acids Res. 1996 Jun 15;24(12):2411-5.
PMID: 8710514

Estevenon AM, Kooistra J, Sicard N.
An Escherichia coli strain deficient for both exonuclease V and deoxycytidine triphosphate deaminase shows enhanced sensitivity to
ionizing radiation.
Mol Gen Genet. 1995 Feb 20;246(4):514-8.
PMID: 7891665

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to deoxycytidine triphosphate deaminase protein; e.g. residues 1-181 are 81% similar to U32699) deoxycytidine triphosphate deaminase of Haemophilus influenzae, residues 1-193 are 72% similar to (M90069) deoxycytidine triphosphate deaminase of Escherichia coli, residues 3-193 are 41% similar to (AE000937) deoxycytidine triphosphate deaminase of Methanobacterium thermoautotrphicum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0717
COG name: Deoxycytidine deaminase
Functional Class:  F
The phylogenetic pattern of COG0717 is aMTk-q-ce-rhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003232 (dCTP Deaminase) with a combined E-value of 3.4e-56.
    IPB003232A    1-9
    IPB003232B    32-44
    IPB003232C    85-123
    IPB003232D    128-141
    IPB003232E    146-174


ProDom Summary:  Protein Domain Search
Residues 127-191 are 78% similar to a (DEAMINASE TRIPHOSPHATE DEOXYCYTIDINE) protein domain (PD004900) which is seen in DCD_PASMU.

Residues 1-120 are 53% similar to a (DEAMINASE TRIPHOSPHATE DEOXYCYTIDINE) protein domain (PD355632) which is seen in DCD_BUCAI.

Residues 1-126 are 82% similar to a (DEAMINASE DCTP TRIPHOSPHATE HYDROLASE) protein domain (PD336841) which is seen in DCD_HAEIN.



Paralogs:  Local Blast Search

HD1661 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 50 to 189 (E-value = 6.2e-25) place HD1661 in the dUTPase family which is described as dUTPase (PF00692)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRLCDTDIEHYLDQDLINISPRPTNDKISGATVDVRLGNSFRVFREHATP
YIDLSGPREQVSAQLEKIMSDEIILAEGEAFFLHPGELALATTLESVKLP
DNIVGWLDGRSSLARLGLMVHVTAHRIDPGWHGKIVLEFFNAGKLPLALR
PNMAIGALSFEVLSGAAAKPYNAREDAKYKNQQSAISSRINEDK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTCTATGTGATACCGATATTGAGCATTATTTAGATCAAGATCTCAT
TAACATTAGCCCTCGCCCAACTAATGATAAAATTTCTGGTGCGACCGTTG
ATGTGCGACTAGGAAATTCATTCCGTGTTTTTCGTGAGCACGCCACACCT
TATATTGATTTAAGTGGGCCTCGTGAACAAGTCAGCGCACAACTTGAAAA
AATCATGAGTGATGAAATTATTTTAGCAGAAGGTGAAGCTTTTTTCCTTC
ATCCAGGCGAATTAGCCTTGGCCACTACCCTAGAGTCAGTGAAATTACCG
GATAATATTGTTGGTTGGCTAGATGGACGTTCTTCATTGGCTCGCTTAGG
ATTAATGGTACATGTTACCGCTCATCGCATTGATCCAGGTTGGCACGGCA
AAATTGTATTAGAATTCTTTAATGCTGGTAAACTACCATTAGCCTTGCGT
CCTAATATGGCGATTGGTGCATTAAGCTTTGAAGTATTGAGTGGAGCAGC
GGCTAAGCCTTATAACGCCCGTGAAGATGCAAAATATAAAAATCAACAAA
GTGCGATTTCAAGTCGTATCAATGAAGATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy