Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1214 IGR1216 IGR1209 IGR1210 IGR1211 IGR1215 IGR1212 IGR1213 IGR1217 HD1656 HD1657 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 HD1656 HD1657 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664 HD1657 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 HD1656 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 spoU, - HD1664
* Calculated from Protein Sequence

Gene ID: HD1660

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
udk  

Definition:
uridine kinase

Gene Start:
1381937

Gene Stop:
1382590

Gene Length:
654

Molecular Weight*:
24989

pI*:
8.00

Net Charge*:
2.55

EC:
2.7.1.48  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Schuster S, Zevedei-Oancea I.
Treatment of multifunctional enzymes in metabolic pathway analysis.
Biophys Chem. 2002 Sep 3;99(1):63.
PMID: 12223240

Boursaux-Eude C, Margarita D, Gilles AM, Barzu O, Saint Girons I.
Borrelia burgdorferi uridine kinase: an enzyme of the pyrimidine salvage pathway for endogenous use of nucleotides.
FEMS Microbiol Lett. 1997 Jun 15;151(2):257-61.
PMID: 9228761

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to uridine kinase protein; e.g. residues 29-217 are 58% similar to (U32699) uridine kinase (udk) of Haemophilus influenzae, residues 29-212 are 59% similar to (D90845) Uridine kinase of Escherichia coli, residues 29-216 are 40% similar to (Z99117) uridine kinase of Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0572
COG name: Uridine kinase
Functional Class:  F
The phylogenetic pattern of COG0572 is ----Y-vceb-h--gpol-n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00988 (Uridine kinase signature) with a combined E-value of 8e-47.
    PR00988A    10-27
    PR00988B    44-55
    PR00988C    89-104
    PR00988D    145-155
    PR00988E    159-170
    PR00988F    181-194
***** IPB001324 (Phosphoribulokinase family) with a combined E-value of 4.3e-20.
    IPB001324A    9-30
    IPB001324C    112-123
    IPB001324D    138-188


ProDom Summary:  Protein Domain Search
Residues 136-214 are 81% similar to a (KINASE URIDINE COMPLETE MONOPHOSPHOKINASE) protein domain (PD003826) which is seen in Q9CM85_PASMU.

Residues 29-132 are 50% similar to a (KINASE URIDINE TRANSFERASE ATP-BINDING) protein domain (PD003288) which is seen in Q9CM85_PASMU.



Paralogs:  Local Blast Search

HD1660 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 202 (E-value = 5.3e-43) place HD1660 in the PRK family which is described as Phosphoribulokinase / Uridine kinase family (PF00485)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPETIENQACIVIAIAGASASGKSLIASTIYKELKEELDSNDIDIISEDA
YYKDQTHLTMDEREQTNYDHPDSMVHYLLVEHLRQLKQGKPIQIPEYDYA
KHNRKTSSKHFEPKKIIILEGILLLTHETIRNEINVSIFVDAPLDICFIR
RLQRDLIERGRSMDSVISQCRKTVRPMFLKFIEPSKQYADIIIPKGGKNR
IAIDILKAQIKQLLSKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAGAAACCATTGAAAATCAAGCTTGTATCGTTATTGCTATTGCAGG
TGCTTCTGCTTCAGGTAAAAGCCTTATTGCTTCTACCATTTATAAAGAAC
TGAAAGAAGAATTAGATTCCAATGATATCGATATTATTTCTGAAGATGCT
TATTATAAAGATCAAACGCATTTAACGATGGATGAACGTGAGCAAACCAA
TTACGATCATCCCGATTCAATGGTTCACTATCTATTAGTTGAACACCTTC
GCCAACTAAAGCAAGGAAAGCCCATTCAAATTCCTGAATATGATTATGCT
AAGCACAATCGAAAAACATCTAGTAAGCATTTTGAACCCAAAAAAATTAT
TATTTTAGAAGGCATTTTATTGTTAACGCATGAAACAATCCGCAATGAAA
TTAATGTTTCAATCTTTGTTGACGCGCCATTAGATATTTGTTTCATTCGC
CGTTTACAGCGTGATTTAATCGAACGTGGTCGCTCAATGGATTCGGTCAT
ATCGCAATGCCGAAAAACTGTCCGCCCAATGTTTTTAAAATTTATTGAGC
CATCTAAACAATATGCCGATATTATTATACCCAAAGGCGGTAAAAACCGG
ATTGCGATCGATATATTAAAAGCCCAAATCAAACAATTATTATCAAAAAA
ATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy