Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1214 IGR1216 IGR1208 IGR1209 IGR1210 IGR1211 IGR1215 IGR1212 IGR1213 IGR1217 HD1656 HD1657 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 HD1654 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 HD1656 HD1657 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 HD1654 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659 HD1657 nlpD, - HD1658 pntB, - HD1662 pntA, - HD1663 HD1655 HD1654 HD1656 dcd, - HD1661 udk, - HD1660 gpmA, - HD1659
* Calculated from Protein Sequence

Gene ID: HD1659

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gpmA  

Definition:
phosphoglyceromutase

Gene Start:
1381050

Gene Stop:
1381739

Gene Length:
690

Molecular Weight*:
26141

pI*:
7.00

Net Charge*:
0.00

EC:
5.4.2.1  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Glycolysis / Gluconeogenesis

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phosphoglycerate mutase protein; e.g. residues 3-229 are 83% similar to U32760) phosphoglycerate mutase (gpmA) of Haemophilus influenzae, residues 3-229 are 78% similar to (AE002510) phosphoglycerate mutase of Neisseria meningitidis, residues 3-229 are 60% similar to (AJ131985) phosphoglyceromutase of Streptococcus pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0588
COG name: Phosphoglycerate mutase 1
Functional Class:  G
The phylogenetic pattern of COG0588 is ----Y---e-rh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001345 (Phosphoglycerate mutase family) with a combined E-value of 2.3e-44.
    IPB001345A    5-34
    IPB001345B    54-66
    IPB001345C    78-109
    IPB001345D    148-166


ProDom Summary:  Protein Domain Search
Residues 94-224 are 86% similar to a (PGAM MUTASE PHOSPHOGLYCERATE ISOMERASE) protein domain (PD003480) which is seen in PMGY_HAEIN.

Residues 8-92 are 80% similar to a (MUTASE PROTEOME COMPLETE PHOSPHOGLYCERATE PGAM) protein domain (PD000730) which is seen in Q9CKU9_PASMU.



Paralogs:  Local Blast Search

HD1659 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 227 (E-value = 6.7e-125) place HD1659 in the PGAM family which is described as Phosphoglycerate mutase family (PF00300)

PDB Hit:
pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex S... 228 4e-061
pdb|4PGM|B Chain B, Saccharomyces Cerevisiae Phosphoglycerate M... 228 4e-061
pdb|3PGM| Phosphoglycerate Mutase (E.C.2.7.5.3) De-Phospho E... 210 1e-055

Gene Protein Sequence:
VFMELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGQKLLAAGYE
FDIAFTSVLTRAIKTCNIVLEESNQLWIPQVKHWRLNERHYGELQGLDKK
ATAEKYGDEQVHIWRRSYDTLPPLLAPSDPNSAHNDRRYAHLPKEVVPNG
ENLKVTLERVLPFWEDQIAPALLSGKRVLVTAHGNSLRALAKHIIGISDA
EIMDFEIPTGQPLVLKLDSKLNFIEKFYL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTTATGGAATTAGTATTTATTCGTCACGGATTTAGTGAATGGAATGC
GAAAAACTTATTTACTGGTTGGCGCGATGTGAATCTAACCGAACGAGGCG
TTGAAGAAGCAAAAGCCGCAGGCCAAAAACTCTTAGCTGCGGGATATGAA
TTTGATATCGCATTCACTTCCGTACTGACTCGTGCAATCAAAACGTGTAA
TATTGTATTAGAAGAATCTAATCAATTATGGATTCCACAGGTGAAACATT
GGCGTTTAAATGAGCGTCATTATGGTGAATTACAAGGCTTAGATAAAAAA
GCCACGGCAGAAAAATATGGCGATGAACAAGTACATATTTGGCGCCGTTC
TTATGATACCCTACCACCACTATTAGCACCATCAGATCCAAATTCAGCCC
ATAATGATCGCCGTTATGCGCACCTACCCAAAGAAGTTGTGCCAAATGGC
GAGAATTTAAAAGTCACTTTAGAACGTGTTCTGCCATTTTGGGAAGATCA
AATTGCCCCGGCATTATTATCTGGCAAACGCGTTTTAGTAACGGCCCACG
GTAATTCATTACGCGCACTTGCCAAACATATTATCGGGATTTCTGATGCT
GAAATTATGGACTTTGAGATTCCAACAGGTCAACCATTAGTTTTAAAATT
AGACAGCAAATTAAATTTCATTGAAAAATTTTATTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy