Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1207 IGR1206 IGR1204 IGR1201 IGR1202 IGR1203 IGR1205 HD1645 HD1653 HD1650 glpR, - HD1648 ubiA, - HD1647 purB, - HD1649 cydC, - HD1651 cydD, - HD1652 gyrB, - HD1643 HD1644 HD1645 HD1653 HD1650 glpR, - HD1648 ubiA, - HD1647 purB, - HD1649 cydC, - HD1651 cydD, - HD1652 gyrB, - HD1643 HD1644 HD1645 HD1653 HD1650 glpR, - HD1648 ubiA, - HD1647 purB, - HD1649 cydC, - HD1651 cydD, - HD1652 gyrB, - HD1643 HD1646 HD1644 HD1646
* Calculated from Protein Sequence

Gene ID: HD1649

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purB  

Definition:
adenylosuccinate lyase

Gene Start:
1368582

Gene Stop:
1367203

Gene Length:
1380

Molecular Weight*:
52407

pI*:
6.30

Net Charge*:
-5.06

EC:
4.3.2.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Alanine and aspartate metabolism
Purine metabolism

Secondary Evidence:
He B, Smith JM, Zalkin H.
Escherichia coli purB gene: cloning, nucleotide sequence, and regulation by purR.
J Bacteriol. 1992 Jan;174(1):130-6.
PMID: 1729205

Helling RB, Janes BK, Kimball H, Tran T, Bundesmann M, Check P, Phelan D, Miller C.
Toxic waste disposal in Escherichia coli.
J Bacteriol. 2002 Jul;184(13):3699-703.
PMID: 12057966

Green SM, Malik T, Giles IG, Drabble WT.
The purB gene of Escherichia coli K-12 is located in an operon.
Microbiology. 1996 Nov;142 ( Pt 11):3219-30.
PMID: 8969519

Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to adenylosuccinate lyases from H. influenzae (1073820 & 1172761), E. coli (2506199, 145203 & 281807), N. meningitidis MC58 (7225509), among others.

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0015
COG name: Adenylosuccinate lyase
Functional Class:  F
The phylogenetic pattern of COG0015 is amtkyqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000362 (Fumarate lyase) with a combined E-value of 2.8e-14.
    IPB000362A    172-185
    IPB000362B    298-308


ProDom Summary:  Protein Domain Search
Residues 411-459 are 69% similar to a (LYASE ADENYLOSUCCINATE PROTEOME COMPLETE) protein domain (PD330505) which is seen in Q9KSY0_VIBCH.

Residues 47-186 are 52% similar to a (LYASE ADENYLOSUCCINATE ASL BIOSYNTHESIS) protein domain (PD408312) which is seen in Q9K183_NEIMB.

Residues 195-428 are 86% similar to a (LYASE ADENYLOSUCCINATE BIOSYNTHESIS) protein domain (PD328331) which is seen in Q9CJY7_PASMU.

Residues 290-373 are 92% similar to a (LYASE ADENYLOSUCCINATE PROTEOME COMPLETE) protein domain (PD232438) which is seen in PUR8_HAEIN.

Residues 46-187 are 76% similar to a (LYASE ADENYLOSUCCINATE COMPLETE PROTEOME) protein domain (PD245535) which is seen in Q9CJY7_PASMU.

Residues 7-45 are 84% similar to a (LYASE ADENYLOSUCCINATE COMPLETE PROTEOME) protein domain (PD325176) which is seen in Q9CJY7_PASMU.

Residues 252-285 are 91% similar to a (LYASE ADENYLOSUCCINATE COMPLETE PURINE) protein domain (PD280744) which is seen in PUR8_ECOLI.

Residues 188-251 are 78% similar to a (LYASE ADENYLOSUCCINATE PROTEOME COMPLETE) protein domain (PD128429) which is seen in PUR8_HAEIN.

Residues 377-410 are 91% similar to a (LYASE ADENYLOSUCCINATE COMPLETE PURINE) protein domain (PD398422) which is seen in PUR8_ECOLI.



Paralogs:  Local Blast Search

HD1649 is paralogously related to HD1986 (2e-04).


Pfam Summary:  Pfam Search
Residues 18 to 325 (E-value = 7.1e-89) place HD1649 in the Lyase_1 family which is described as Lyase (PF00206)

PDB Hit:
pdb|1F1O|A Chain A, Structural Studies Of Adenylosuccinate Lyases 116 7e-027
pdb|1C3C|A Chain A, T. Maritima Adenylosuccinate Lyase >gi|7245... 107 3e-024
pdb|1C3U|A Chain A, T. Maritima Adenylosuccinate Lyase >gi|7245... 107 3e-024

Gene Protein Sequence:
LEKIMEVTALTALSPIDGRYQDKTNALRTIFSEFGLLKFRVTVEVRWLQK
LASHPQISEVSALSQKANDYLDQIVANFSIDDAKRIKMIERETNHDVKAV
EYFLKEKCNALAELQAINEFIHFACTSEDINNTSHALMLKMAREEVLLPE
WQKLIDAIVELAKRYQHIPLLSRTHGQPASPTTIGKEMANVAYRLRRQYK
QLQNLDILAKINGAVGNYNAHLSAYPEIDWHTFGQQFVESLGVNWNPYTT
QIEPHDYIAEFFDCVARFNTIMIDFDRDMWGYIALNHFKQRTVAGEIGSS
TMPHKVNPIDFENSEGNLGLANAVMAHLGQKLPVSRWQRDLTDSTVLRNL
GVGLGYCLIAYSATLKGISKLEVNEQHLQDELNQNWEVLAEPIQTVMRRY
GIEKPYEKLKELTRGKCVNEAVIRQFIDTLAIPESEKARLKEMSPATYIG
YAIELVDKL$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAGAAAATAATGGAAGTTACTGCTTTAACAGCATTATCGCCGATTGA
TGGTCGTTACCAAGATAAAACAAATGCACTTCGCACAATTTTTAGTGAAT
TTGGCTTACTCAAATTTCGAGTAACTGTGGAAGTGCGTTGGTTACAAAAA
TTGGCATCACATCCACAAATTAGCGAAGTTTCAGCTTTGTCGCAAAAGGC
AAACGATTACTTAGATCAAATTGTGGCAAACTTTTCCATTGATGATGCTA
AGCGCATAAAAATGATTGAGCGTGAAACTAATCACGATGTAAAAGCAGTT
GAATATTTTTTGAAAGAAAAATGTAATGCATTAGCTGAATTACAAGCGAT
TAATGAATTTATTCATTTTGCTTGTACCTCAGAAGATATTAATAACACTT
CTCACGCATTAATGTTAAAAATGGCACGTGAAGAAGTATTATTACCAGAA
TGGCAAAAATTGATTGATGCAATTGTTGAGCTTGCTAAACGTTATCAACA
TATTCCACTACTGTCTCGTACACACGGTCAACCTGCGAGCCCGACCACTA
TTGGTAAAGAAATGGCGAATGTGGCTTATCGTTTGCGCCGTCAATATAAA
CAATTACAAAATTTAGATATTTTAGCTAAAATTAATGGCGCCGTTGGAAA
CTATAATGCACATTTATCAGCTTATCCAGAAATTGATTGGCATACCTTTG
GTCAACAATTTGTTGAATCTTTAGGAGTTAATTGGAATCCATATACCACA
CAAATTGAACCACACGATTATATTGCAGAGTTTTTTGATTGTGTAGCACG
TTTTAATACGATTATGATTGATTTTGATCGTGATATGTGGGGCTATATTG
CGTTAAATCATTTTAAACAGCGTACTGTTGCTGGAGAGATTGGATCATCA
ACAATGCCTCATAAAGTGAATCCGATTGACTTTGAAAATTCAGAAGGTAA
CTTGGGTTTAGCTAATGCCGTGATGGCGCATTTAGGACAAAAATTGCCAG
TTTCACGTTGGCAACGTGATTTAACTGATTCTACAGTATTACGTAATCTT
GGTGTTGGTTTAGGCTATTGCTTAATTGCCTATTCAGCCACTTTAAAAGG
CATCAGCAAATTAGAAGTGAATGAACAGCATTTACAAGATGAATTAAATC
AAAATTGGGAAGTGTTAGCTGAACCCATTCAGACTGTGATGCGTCGCTAT
GGTATTGAAAAACCATATGAAAAACTTAAAGAATTAACACGTGGTAAATG
TGTAAATGAAGCCGTTATACGGCAGTTTATTGATACGCTCGCCATTCCAG
AAAGTGAAAAAGCACGTTTAAAAGAAATGAGCCCGGCTACTTATATTGGA
TATGCGATTGAGCTTGTAGATAAGTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy