Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1199 IGR1204 IGR1201 IGR1202 IGR1203 IGR1200 IGR1205 IGR1198 HD1645 HD1650 glpR, - HD1648 ubiA, - HD1647 purB, - HD1649 cydC, - HD1651 gyrB, - HD1643 HD1644 HD1642 purR,rbsR, - HD1641 HD1645 HD1650 glpR, - HD1648 ubiA, - HD1647 purB, - HD1649 cydC, - HD1651 gyrB, - HD1643 HD1644 HD1642 purR,rbsR, - HD1641 HD1645 HD1650 glpR, - HD1648 ubiA, - HD1647 purB, - HD1649 cydC, - HD1651 gyrB, - HD1643 HD1642 purR,rbsR, - HD1641 HD1646 HD1644 HD1646
* Calculated from Protein Sequence

Gene ID: HD1647

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ubiA  

Definition:
4-hydroxybenzoate octaprenyltransferase

Gene Start:
1366324

Gene Stop:
1365482

Gene Length:
843

Molecular Weight*:
31657

pI*:
8.90

Net Charge*:
4.76

EC:
2.5.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
N-Glycans biosynthesis
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Melzer,M. and Heide,L.
Characterization of polyprenyldiphosphate: 4-hydroxybenzoate polyprenyltransferase from Escherichia coli.
Biochim. Biophys. Acta 1212(1): 93-102, 1994.
Medline: 94207029.

Siebert,M., Bechthold,A., Melzer,M., May,U., Berger,U., Schroder,G., Schroder,J., Severin,K. and Heide,L.
Ubiquinone biosynthesis. Cloning of the genes coding for chorismate pyruvate-lyase and 4-hydroxybenzoate octaprenyl transferase from Escherichia coli.
FEBS Lett. 307(3): 347-350, 1992.
Medline: 92354744.


Comment:


Blast Summary:  PSI-Blast Search
Residues 1-278 are 55% similar to 13431965 UBIA_PASMU 4-hydroxybenzoate octaprenyltransferase (4-HB polyprenyltransferase).

A few significant hits using gapped BLAST to 4-hydroxybenzoate octaprenyltransferases from E. coli (136658 & 396375), Providencia stuartii (6136094), N. meningitidis MC58 (7225963), among others.

HD1647 is weakly similar to predicted 4-hydroxybenzoate octaprenyltransferases from C. trachomatis (CT219) and C. pneumoniae (CPn0265). No similarity to sequences from M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0382
COG name: 4-hydroxybenzoate octaprenyltranferase
Functional Class: H
The phylogenetic pattern of COG0382 is AmTkyq-Ce---uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000537 (UbiA prenyltransferase) with a combined E-value of 2.2e-36.
    IPB000537A    44-86
    IPB000537B    121-151


ProDom Summary:  Protein Domain Search
Residues 125-233 are 68% similar to a (TRANSFERASE PROTEOME) protein domain (PD124505) which is seen in UBIA_PASMU.

Residues 49-123 are 50% similar to a (TRANSFERASE PROTEOME COMPLETE SYNTHASE TRANSMEMBRANE) protein domain (PD081407) which is seen in UBIA_PASMU.



Paralogs:  Local Blast Search
HD1647 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 15 to 277 (E-value = 4.4e-66) place HD1647 in the UbiA family which is described as UbiA prenyltransferase family (PF01040)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LAYMQLMRFDKPIGTLLLLHPTLWALFAAAGGIPSSSILIIFILGVIVMR
AAGCVINDYADRHIDGKVKRTSQRPLATGRVTTVEAKVLFFVLLIIAFLL
DLSLNQYAFLLSFVAVALAVIYPFMKRFTHLPQVVLGMAFGWAIPMAYGA
VIEDLPLTCWLLFLANILWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQY
DNKIIALLQFLSLILFILFGWLSEYHIGYFIVLALTSTLFIYQCWLTKQR
VREQCFKAFLNNNYFGFGIFIAILVGIYGF$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCATACATGCAGTTAATGCGTTTTGATAAGCCAATTGGGACTCTATT
ACTTCTTCACCCAACATTATGGGCATTATTTGCTGCAGCAGGCGGTATCC
CGTCTAGTTCAATATTAATTATTTTTATACTAGGCGTGATTGTCATGCGT
GCAGCAGGTTGTGTGATTAATGATTATGCAGATCGCCATATAGATGGCAA
AGTTAAACGAACCTCACAACGGCCATTGGCAACAGGTCGTGTAACCACTG
TTGAAGCTAAAGTGTTATTTTTTGTACTGTTAATCATTGCATTTTTATTG
GATTTATCACTCAATCAATACGCATTTTTGCTTTCATTTGTTGCCGTGGC
ATTAGCGGTTATTTATCCGTTTATGAAACGTTTTACGCACTTGCCTCAAG
TCGTACTTGGTATGGCTTTTGGCTGGGCGATTCCTATGGCATATGGTGCA
GTGATTGAAGATTTGCCGTTAACATGTTGGTTATTATTTTTAGCTAATAT
TTTATGGACAGTTGCTTACGATACGCAGTATGCAATGGTTGATCGTGATG
ATGATTTACGTATTGGAGTTAAATCAACCGCTATTTTATTCGCACAATAC
GACAATAAAATTATTGCGCTATTACAATTTTTGTCACTCATTTTATTTAT
TCTGTTTGGGTGGTTAAGTGAATATCACATTGGTTATTTTATTGTATTAG
CCTTAACTTCAACCTTATTTATTTATCAATGTTGGTTAACAAAACAACGG
GTTAGAGAGCAATGTTTTAAAGCATTCTTAAATAATAATTACTTTGGTTT
CGGCATTTTCATCGCGATTCTAGTGGGCATTTATGGTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy