Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-4 tRNA-Leu-4 IGR1197 IGR1199 IGR1192 IGR1195 IGR1193 IGR1200 IGR1191 IGR1198 IGR1194 IGR1196 HD1640 mltA, - HD1636 cafA, - HD1631 gyrB, - HD1643 HD1634 xseA, - HD1637 HD1642 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1640 mltA, - HD1636 cafA, - HD1631 gyrB, - HD1643 HD1634 xseA, - HD1637 HD1642 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1640 mltA, - HD1636 cafA, - HD1631 gyrB, - HD1643 xseA, - HD1637 HD1642 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1633 HD1634 HD1633
* Calculated from Protein Sequence

Gene ID: HD1638

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
xseA  

Definition:
exodeoxyribonuclease VII large subunit

Gene Start:
1357529

Gene Stop:
1358314

Gene Length:
786

Molecular Weight*:
30115

pI*:
10.30

Net Charge*:
11.26

EC:
3.1.11.6  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Chase,J.W., Rabin,B.A., Murphy,J.B., Stone,K.L. and Williams,K.R.
Escherichia coli exonuclease VII. Cloning and sequencing of the
gene encoding the large subunit (xseA)
J. Biol. Chem. 261 (32), 14929-14935 (1986)
Medline: 87033720

Vales,L.D., Rabin,B.A. and Chase,J.W.
Subunit structure of Escherichia coli exonuclease VII
J. Biol. Chem. 257 (15), 8799-8805 (1982)
Medline: 82239360



Comment:
From Genbank:[gi:1169574]
This enzyme bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded furthur into small acid-solube oligonucleotides.


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to exodeoxyribonuclease VII large subunit proteins from H. influenzae (1169574), E. coli (148275 & 2507019), Pseudomonas fluorescens (3869268), among others.

HD1638 is similar to predicted exodeoxyribonuclease VII large subunit proteins from C. pneumoniae (CPn1062) and C. trachomatis (CT329). No similarity to sequences from M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1570
COG name: Exonuclease VII, large subunit
Functional Class: L
The phylogenetic pattern of COG1570 is ------v-ebrhUj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003753 (Exonuclease VII, large subunit) with a combined E-value of 3.5e-85.
    IPB003753D    3-35
    IPB003753E    36-76
    IPB003753F    84-134
    IPB003753G    180-224
    IPB003753F    174-224
    IPB003753F    129-179
    IPB003753F    73-123


ProDom Summary:  Protein Domain Search
Residues 41-118 are 57% similar to a (EXONUCLEASE VII LARGE SUBUNIT) protein domain (PD010734) which is seen in EX7L_ECOLI.

Residues 185-259 are 41% similar to a (LARGE VII SUBUNIT EXONUCLEASE) protein domain (PD407053) which is seen in EX7L_VIBCH.

Residues 145-257 are 43% similar to a (EXONUCLEASE VII LARGE SUBUNIT) protein domain (PD020865) which is seen in EX7L_HAEIN.

Residues 1-40 are 75% similar to a (LARGE VII SUBUNIT EXONUCLEASE) protein domain (PD013688) which is seen in EX7L_PASMU.



Paralogs:  Local Blast Search
HD1638 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 188 (E-value = 3.6e-59) place HD1638 in the Exonuc_VII_L family which is described as Exonuclease VII, large subunit (PF02601)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VASINLANRRNECDLLIIARGGGSLEDLWCFNEEIVAYAIFHSQLPIVSA
IGHETDITIADFVADLRAPTPSAAAELVSRDQQELIRQLHHQFDKINLAF
DRLWSHKLNRFEWLTLRLTAQHPKRQLQIQQKQLIHIKHRLTATITQLFA
TKKQRWQALTQYVKHNKLPHYVASNMQYFNQLSQRLNFTIEKKLSQEQQK
FQELCTRIDGLSPLKILARGYSVTQNQQGKIIYDAKQIAVGDRIETQLSR
GNIVSEVISIK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCAAGCATTAATTTAGCTAATCGACGTAATGAATGTGATCTTTTAAT
TATCGCAAGAGGCGGTGGCTCCTTAGAAGATTTATGGTGTTTTAATGAAG
AAATTGTGGCGTATGCTATTTTTCACTCTCAACTTCCGATTGTGAGTGCG
ATCGGGCACGAAACAGATATCACGATTGCTGATTTTGTGGCTGATTTACG
CGCGCCAACGCCTTCAGCCGCAGCAGAATTAGTTAGTCGTGATCAACAAG
AATTAATTCGCCAATTACATCACCAATTTGACAAAATTAACCTTGCCTTT
GACCGCTTATGGTCACATAAACTAAATAGATTTGAGTGGCTAACCCTACG
CTTAACCGCACAACATCCAAAACGCCAATTACAGATACAACAAAAACAGC
TCATTCATATTAAACACCGCTTAACGGCTACTATCACACAACTATTTGCA
ACCAAAAAACAACGCTGGCAAGCATTAACTCAATACGTAAAGCATAACAA
GCTTCCACATTATGTTGCAAGTAACATGCAATATTTTAATCAACTATCGC
AACGATTAAACTTTACAATAGAGAAAAAGTTAAGCCAAGAACAGCAAAAA
TTCCAAGAATTGTGCACACGTATTGATGGCTTAAGCCCGTTAAAAATACT
TGCTAGAGGCTATTCAGTTACACAAAATCAGCAAGGAAAGATTATTTATG
ATGCAAAACAAATTGCAGTCGGTGATCGAATTGAAACACAATTATCGAGA
GGCAATATTGTCAGTGAAGTCATCAGTATCAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy