Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-4 tRNA-Leu-4 IGR1197 IGR1199 IGR1192 IGR1190 IGR1195 IGR1193 IGR1191 IGR1198 IGR1194 IGR1196 HD1640 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 HD1642 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1640 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 HD1642 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1640 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 xseA, - HD1637 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1633 HD1634 HD1642 HD1633
* Calculated from Protein Sequence

Gene ID: HD1637

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
xseA  

Definition:
exodeoxyribonuclease VII large subunit

Gene Start:
1356990

Gene Stop:
1357454

Gene Length:
465

Molecular Weight*:
17509

pI*:
10.00

Net Charge*:
3.71

EC:
3.1.11.6  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Chase,J.W., Rabin,B.A., Murphy,J.B., Stone,K.L. and Williams,K.R.
Escherichia coli exonuclease VII. Cloning and sequencing of the
gene encoding the large subunit (xseA)
J. Biol. Chem. 261 (32), 14929-14935 (1986)
Medline: 87033720

Vales,L.D., Rabin,B.A. and Chase,J.W.
Subunit structure of Escherichia coli exonuclease VII
J. Biol. Chem. 257 (15), 8799-8805 (1982)
Medline: 82239360


Comment:
From Genbank:[gi:1169574]
This enzyme bidirectionally degrades single-stranded DNA into acid-insoluble oligonucleotides, which are then degraded furthur into small acid-soluble oligonucleotides.





Blast Summary:  PSI-Blast Search
Several strong hits using gapped BLAST to exodeoxyribonuclease VII large subunit proteins form H. influenzae (1169574), E. coli (2507019, 148275), Neisseria meningitidis MC58 (7226608), Neisseria meningitidis (7380216), B. subtilis (1706723), among others.

HD1637 is similar to exodeoxyribonuclease VII proteins from C. trachomatis (CT329) and C. pneumoniae (CPn1062). No similarity to sequences from M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1570
COG name: Exonuclease VII, large subunit
Functional Class: L
The phylogenetic pattern of COG1570 is ------v-ebrhUj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003753 (Exonuclease VII, large subunit) with a combined E-value of 3.7e-55.
    IPB003753A    24-59
    IPB003753B    60-93
    IPB003753C    109-147


ProDom Summary:  Protein Domain Search
Residues 8-128 are 73% similar to a (LARGE VII SUBUNIT EXONUCLEASE) protein domain (PD013688) which is seen in EX7L_HAEIN.



Paralogs:  Local Blast Search

HD1637 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 25 to 100 (E-value = 2.5e-09) place HD1637 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNNILTITQLNYSVRHLLEMEIGQVWLTGEISNFTKPTSGHWYLTLKDEQ
AQVRAAMFRMKNQYVTFQPANGMQVLVLANVSLYEPRGDYQIIIDSMQLA
GDGLLQKQFEQLKLTLAAKGLFAQSNKKNYLVLPSGLVSLPHQPAPYYKI
YLIS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAATATTCTTACAATTACACAATTAAACTATTCTGTTAGACACCT
ATTAGAAATGGAAATTGGCCAAGTATGGCTGACTGGAGAAATCTCAAACT
TCACTAAGCCAACATCAGGCCATTGGTATCTCACATTAAAAGATGAACAA
GCACAGGTCAGAGCCGCCATGTTCCGCATGAAAAATCAATATGTTACCTT
TCAACCGGCTAATGGTATGCAAGTCTTAGTGTTAGCAAATGTCAGTTTAT
ATGAACCAAGAGGCGACTATCAAATTATTATTGATAGTATGCAATTAGCC
GGTGATGGCTTATTACAGAAACAATTTGAACAACTCAAATTAACACTTGC
TGCGAAAGGACTTTTTGCACAATCAAACAAAAAAAATTACCTAGTTTTGC
CAAGCGGATTGGTATCATTACCTCATCAACCGGCGCCGTATTACAAGATA
TACTTAATATCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy