Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-4 tRNA-Leu-4 IGR1197 IGR1192 IGR1190 IGR1195 IGR1193 IGR1191 IGR1198 IGR1194 IGR1196 HD1640 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1640 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1640 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 xseA, - HD1637 xseA, - HD1638 HD1632 purR,rbsR, - HD1641 uhpT, - HD1639 HD1633 HD1634 HD1633
* Calculated from Protein Sequence

Gene ID: HD1636

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mltA  

Definition:
lytic murein transglycosylase A (murein hydrolase A)

Gene Start:
1356585

Gene Stop:
1355479

Gene Length:
1107

Molecular Weight*:
40968

pI*:
10.50

Net Charge*:
19.32

EC:
3.2.1.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism
Glycosaminoglycan degradation
Nucleotide sugars metabolism

Primary Evidence:
NULL

Secondary Evidence:
Lommatzsch,J., Templin,M.F., Kraft,A.R., Vollmer,W. and Holtje,J.V.
Outer membrane localization of murein hydrolases: MltA, a third lipoprotein lytic transglycosylase in Escherichia coli. J. Bacteriol. 179(17): 5465-5470, 1997.
Medline: 97431497.

Ursinus,A. and Holtje,J.V.
Purification and properties of a membrane-bound lytic
transglycosylase from Escherichia coli
J. Bacteriol. 176 (2), 338-343 (1994)
MEDLINE: 94117367

Vollmer,W., von Rechenberg,M. and Holtje,J.V.
Demonstration of molecular interactions between the murein
polymerase PBP1B, the lytic transglycosylase MltA, and the
scaffolding protein MipA of Escherichia coli
J. Biol. Chem. 274 (10), 6726-6734 (1999)
MEDLINE: 99156961



Comment:
0

Blast Summary:  PSI-Blast Search
A few significant hits using gapped BLAST to predicted membrane-bound lytic murein transglycosylase A proteins (murein hydrolase A) from E. coli (2507394 & 974447).

No similarity to C. trachomatis, C. pneumoniae, M. genitalium, M.
pneumoniae, U. urealyticum or T. pallidum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 76-367 are 71% similar to a (LIPOPROTEIN MEMBRANE OUTER GNA33) protein domain (PD036831) which is seen in Q9CMA6_PASMU.



Paralogs:  Local Blast Search


HD1636 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 109 to 286 (E-value = 8.1e-93) place HD1636 in the MltA family which is described as MltA N-terminal domain (PF03562)
Residues 290 to 368 (E-value = 1.4e-31) place HD1636 in the 3D family which is described as 3D domain (PF06725)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MMMNWNVTKSWFKVAVIATLIAGCSAKHGAHKLTNDQQLEHAKLGAVYTD
RQFSLYNFVRVPTVVAKSPVVNFQDFLKQLNNVRTYATNITGRYDRTYGK
VSAWIAAGGNISELNHYNINALQMRGEDGFQNVLMTGYYSPVINARRSPQ
GKYKHPIYSMPKQKRLTRAEIYYGALAGKSLELAYSDSLLDNFLLGVQGS
GYVNFGDGRLNYFAYAGQNGHKYKSIGRLLVEDGEIAKEKMSIQAIREWG
KKNPHRIQGLLERNPSYVFFKHDPTGQVKGSAGVPLVALASVASDKNLVP
SGSVLLVEMPLIDHHGNWTGKHEMRLMVALDVGGAVKGQHFDLYQGIGER
AGHQAGLMKHYGRVWVLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGATGAATTGGAACGTAACTAAAAGTTGGTTTAAAGTTGCTGTGAT
CGCTACATTAATTGCCGGATGTTCTGCTAAGCATGGGGCTCATAAACTGA
CGAATGATCAGCAACTTGAACATGCAAAATTAGGTGCAGTTTATACTGAT
CGTCAATTTAGTCTTTATAATTTTGTTAGAGTGCCGACTGTGGTGGCGAA
GAGTCCGGTTGTGAATTTTCAAGATTTTTTAAAGCAGTTAAATAATGTTC
GGACTTATGCAACTAATATTACCGGTCGCTATGATCGTACTTATGGCAAA
GTATCCGCTTGGATTGCGGCAGGCGGTAATATTTCAGAGTTGAATCATTA
TAATATTAATGCTTTACAAATGCGTGGTGAAGATGGCTTCCAGAATGTAT
TAATGACGGGGTATTATTCACCGGTTATTAATGCACGCCGTTCACCACAA
GGTAAATATAAACACCCGATTTATTCGATGCCTAAACAAAAACGGCTAAC
GCGAGCTGAAATTTATTACGGAGCATTAGCCGGTAAAAGTTTAGAGTTAG
CTTATAGCGATTCATTGTTAGATAACTTTCTATTAGGTGTACAAGGTAGT
GGTTATGTTAATTTTGGTGATGGGCGTTTAAATTATTTTGCTTATGCGGG
TCAAAATGGCCATAAATATAAAAGTATTGGGCGCTTGTTAGTAGAAGATG
GTGAGATTGCTAAAGAAAAAATGTCTATTCAAGCCATTCGTGAATGGGGC
AAAAAGAACCCGCATCGAATACAAGGTCTATTAGAACGTAATCCATCTTA
TGTCTTCTTTAAACATGATCCGACAGGGCAGGTAAAAGGTTCGGCAGGTG
TGCCTTTGGTCGCGTTGGCTTCAGTGGCATCAGATAAAAATTTAGTGCCT
TCAGGCAGTGTGTTGTTAGTAGAAATGCCTTTGATTGATCATCATGGTAA
TTGGACCGGTAAGCACGAAATGCGTTTGATGGTGGCGTTAGATGTTGGTG
GGGCAGTAAAAGGTCAACATTTTGATTTATACCAAGGCATTGGTGAGCGT
GCTGGTCATCAAGCGGGCTTAATGAAACATTATGGGCGTGTTTGGGTATT
AAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy