Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-4 tRNA-Leu-4 IGR1192 IGR1190 IGR1195 IGR1193 IGR1189 IGR1191 IGR1194 IGR1196 lolB, - HD1629 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 xseA, - HD1638 HD1632 uhpT, - HD1639 lolB, - HD1629 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 xseA, - HD1638 HD1632 uhpT, - HD1639 lolB, - HD1629 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 xseA, - HD1637 xseA, - HD1638 HD1632 uhpT, - HD1639 HD1633 HD1634 HD1633
* Calculated from Protein Sequence

Gene ID: HD1634

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1355054

Gene Stop:
1355413

Gene Length:
360

Molecular Weight*:
13765

pI*:
5.00

Net Charge*:
-3.67

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-82 are 41% similar to >15602118 unknown [Pasteurella multocida].

No similarity to C. trachomatis, C. pneumoniae, M. genitalium, M.
pneumoniae, U. urealyticum or T. pallidum.



COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-82 are 41% similar to a (PROTEOME COMPLETE PM0253) protein domain (PD395994) which is seen in Q9CP15_PASMU.



Paralogs:  Local Blast Search
HD1634 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VEKIMGNPFTAEWTRKQQVMCLGHWIIHYNGKLIDLPKDRYDSDMGTKGI
YNYIDPEDELYLDGLDEDEWIVENIEWLKAIYSLRKIFQLKNKLCAISIK
PCISKTGVADLVAVVFNAL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAAAAATAATGGGAAATCCATTTACCGCGGAGTGGACGCGCAAACA
ACAAGTAATGTGTTTAGGCCATTGGATTATTCACTACAATGGAAAGCTAA
TCGATCTGCCCAAAGATCGCTATGATAGCGATATGGGCACCAAAGGCATT
TATAATTATATTGATCCTGAAGATGAGCTATATTTAGACGGTTTAGATGA
AGATGAATGGATTGTTGAAAACATTGAATGGCTAAAAGCGATCTATTCAT
TGCGGAAAATATTCCAATTGAAGAACAAACTATGCGCTATTTCTATCAAG
CCGTGCATCAGCAAGACTGGCGTTGCGGATCTTGTGGCGGTTGTATTTAA
CGCACTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy