Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Met-4 IGR1192 IGR1187 IGR1190 IGR1195 IGR1193 IGR1189 IGR1191 IGR1194 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 xseA, - HD1638 HD1632 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 HD1634 xseA, - HD1637 xseA, - HD1638 HD1632 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 mltA, - HD1636 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 xseA, - HD1637 xseA, - HD1638 HD1632 HD1633 HD1634 HD1633
* Calculated from Protein Sequence

Gene ID: HD1631

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cafA  

Definition:
probable cytoplasmic axial filament

Gene Start:
1353782

Gene Stop:
1352310

Gene Length:
1473

Molecular Weight*:
55692

pI*:
5.50

Net Charge*:
-11.37

EC:
3.1.4.-  

Functional Class:
Cellular processes; Cell division  

Pathway: pathway table

Secondary Evidence:
Wachi,M., Umitsuki,G., Shimizu,M., Takada,A. and Nagai,K. Escherichia coli cafA gene encodes a novel RNase, designated as RNase G, involved in processing of the 5" end of 16S rRNA. Biochem. Biophys. Res. Commun. 259 (2): 483-488, 1999.
Medline: 99293083.

Okada,Y., Wachi,M., Hirata,A., Suzuki,K., Nagai,K. and Matsuhashi,M.
Cytoplasmic axial filaments in Escherichia coli cells: possible function in the mechanism of chromosome segregation and cell division.
J. Bacteriol. 176 (3): 917-922, 1994.
Medline: 94131972.

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1-490 are 77% similar to 15602207 CafA [Pasteurella multocida].

Otherwise, the two strongest hits using gapped BLAST are to ribonuclease G proteins from H. influenzae (1168735) and E. coli (140751). Other significant hits to cytoplasmic axial filament proteins from E. coli (7465830), N. meningitidis (7227046), Actinobacillus actinomycetemcomitans (3786341), among others. One hit to a hypothetical protein from N. meningitidis (7379400).

HD1631 is similar to predicted axial filament proteins from C. trachomatis (CT808) and C. pneumoniae (CPn0959). No similarity to sequences from M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1530
COG name: Ribonucleases G and E
Functional Class:  J
The phylogenetic pattern of COG1530 is ---k-qvcE-rH------inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 44-110 are 95% similar to a (RIBOSOMAL COMPLETE PROTEOME RNA-BINDING 30S REPEAT) protein domain (PD000709) which is seen in Q9CNT3_PASMU.

Residues 111-277 are 72% similar to a (PROTEOME COMPLETE RIBONUCLEASE FILAMENT) protein domain (PD346341) which is seen in RNG_HAEIN.

Residues 104-392 are 35% similar to a (PROTEOME COMPLETE RIBONUCLEASE FILAMENT) protein domain (PD297013) which is seen in Q9PLB4_CHLMU.

Residues 20-110 are 34% similar to a (PROTEOME COMPLETE CYTOPLASMIC) protein domain (PD262156) which is seen in Q9L1H8_STRCO.

Residues 400-490 are 70% similar to a (PROTEOME COMPLETE AXIAL CYTOPLASMIC) protein domain (PD141890) which is seen in Q9CNT3_PASMU.

Residues 282-396 are 81% similar to a (RIBONUCLEASE PROTEOME COMPLETE HYDROLASE) protein domain (PD007819) which is seen in RNG_HAEIN.

Residues 6-75 are 50% similar to a (FILAMENT PROTEOME COMPLETE AXIAL) protein domain (PD191745) which is seen in Q9K8J2_BACHD.

Residues 3-43 are 80% similar to a (PROTEOME COMPLETE AXIAL CYTOPLASMIC) protein domain (PD346894) which is seen in Q9KUU6_VIBCH.

Residues 45-110 are 77% similar to a (G PROTEOME COMPLETE CYTOPLASMIC) protein domain (PD336989) which is seen in RNG_ECOLI.



Paralogs:  Local Blast Search


HD1631 is paralogously related to HD0194 (8e-75).


Pfam Summary:  Pfam Search
Residues 36 to 123 (E-value = 6.6e-14) place HD1631 in the S1 family which is described as S1 RNA binding domain (PF00575)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTSAELLMNVTPSETRVALVEDGLLKELHIEREAKRGLVGNIYKGRVTRV
LPGMQSAFVDIGLEKAAFLHASDIVSHTECVDESEKKQFVVKDIAELVRE
GQDIIVQVVKDPLGTKGARLTTDITLPSRYLVFMPENSHVGVSQRIESEQ
ERNRLKALVEPHCDELGGFIIRTAAEDVSEESLRQDSIFLKRLWRKILER
KAKYPARSMLYGELALAQRILRDFVGTQISAVRIDSKQTLEQVTDFLNEF
MPELTESVTLYNGSHTLFDYGVEEAIQKALDKRVNLKSGGYLIIEQTEAM
TTIDINTGAFVGHRNLADTIFNTNIEATQAIAHQLQLRNLGGIIIIDFID
MQQEEHRERVLEVLREALKNDRVKTNVNGFTQLGLVEMTRKRTRESLERV
LCCDCPVCNGRGTVKTIETVCYEILREIVRVHYLYSSEKIRVYASKEVAE
YLINEETHASLAELEAFIGKKVEIKLEPYYHQDQFDVVVM$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAGCGCAGAATTATTAATGAATGTAACACCCAGTGAAACCCGCGT
TGCTTTAGTTGAAGATGGTTTGCTGAAGGAACTACATATTGAGCGTGAAG
CGAAACGAGGTTTGGTCGGCAATATTTATAAAGGACGCGTGACACGAGTT
TTGCCAGGTATGCAATCTGCTTTCGTTGATATTGGCTTAGAAAAGGCGGC
ATTTTTACATGCTTCTGATATCGTTTCACATACAGAATGTGTTGATGAAA
GTGAAAAAAAGCAATTTGTAGTAAAAGATATCGCAGAATTAGTTCGCGAA
GGACAAGATATTATTGTGCAAGTCGTTAAAGATCCATTAGGAACCAAAGG
CGCTCGCTTAACAACCGATATTACTTTGCCATCACGCTATTTAGTTTTTA
TGCCGGAAAATAGCCACGTAGGTGTTTCACAACGGATTGAAAGTGAGCAA
GAACGTAATCGTTTAAAAGCGTTAGTTGAACCCCATTGTGATGAACTCGG
CGGTTTTATTATTCGTACTGCGGCAGAAGATGTTTCAGAAGAAAGCCTGC
GACAAGACAGTATTTTTTTAAAACGCTTATGGCGTAAAATTCTAGAACGT
AAAGCAAAATATCCGGCACGTTCAATGCTTTATGGTGAGTTAGCACTTGC
CCAACGCATATTACGTGATTTTGTCGGAACACAAATTAGTGCTGTTCGGA
TTGATTCAAAACAAACACTTGAACAAGTGACAGATTTCTTAAATGAATTT
ATGCCAGAATTAACAGAAAGCGTTACTTTATATAATGGCTCACATACCTT
ATTTGATTATGGTGTAGAAGAAGCTATTCAAAAAGCATTAGATAAACGTG
TTAATTTAAAATCAGGTGGTTATTTAATTATTGAACAAACAGAAGCAATG
ACTACGATTGATATTAATACCGGCGCATTTGTTGGCCATCGTAATTTAGC
GGATACGATTTTCAACACTAATATTGAAGCAACCCAAGCCATCGCACATC
AATTACAGTTGCGTAATTTAGGTGGCATTATCATTATTGATTTTATTGAT
ATGCAGCAAGAAGAACATCGTGAACGCGTATTGGAAGTGCTACGAGAAGC
ATTAAAAAATGATCGTGTTAAAACGAATGTCAATGGTTTCACCCAATTAG
GATTGGTGGAAATGACCCGTAAACGTACGCGTGAAAGCTTAGAGCGAGTA
TTATGTTGTGATTGTCCGGTATGTAATGGGCGTGGTACGGTTAAAACGAT
TGAGACGGTTTGTTATGAAATTTTACGCGAAATTGTGCGCGTGCATTATT
TGTATAGCTCAGAAAAAATTCGCGTATATGCTTCAAAAGAAGTCGCGGAA
TATTTAATTAATGAAGAAACACACGCGTCATTAGCAGAATTAGAAGCGTT
TATTGGTAAAAAAGTAGAAATTAAATTAGAGCCTTATTATCATCAAGATC
AGTTTGATGTGGTCGTCATGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy