Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1187 IGR1190 IGR1186 IGR1189 IGR1191 IGR1185 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 aceE, - HD1625 HD1632 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 aceE, - HD1625 HD1632 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 cafA, - HD1631 msbA,lktB,cvaB, - HD1630 aceE, - HD1625 HD1632
* Calculated from Protein Sequence

Gene ID: HD1628

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ispE  

Definition:
isopentenyl monophosphate kinase

Gene Start:
1349717

Gene Stop:
1348869

Gene Length:
849

Molecular Weight*:
30754

pI*:
6.10

Net Charge*:
-3.02

EC:
2.7.1.-  2.7.1.148  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Other  

Pathway: pathway table
Benzoate degradation via CoA ligation
Circadian rhythm
Inositol phosphate metabolism
Nicotinate and nicotinamide metabolism
Sphingoglycolipid metabolism
Starch and sucrose metabolism
Sterol biosynthesis

Secondary Evidence:
Lange,B.M. and Croteau,R. 1999. Isopentenyl diphosphate biosynthesis via a mevalonate-independent pathway: isopentenyl monophosphate kinase catalyzes the terminal enzymatic step. Proc. Natl. Acad. Sci. U.S.A. 96(24): 13714-13719. Medline: 20040616.


Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST. One to a conserved hypothetical protein from H. influenzae (1074864). Several hits to isopentenyl monophosphate kinase from H. influenzae (1175664), E. coli (140422), S. typhimurium (549526), among others.

HD1628 is similar to conserved hypothetical proteins from C. trachomatis (CT804), T. pallidum (TP0371), and U. urealyticum (UU600). No similarity to proteins from M. genitalium, M. pneumoniae, or C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1947
COG name: Uncharacterized ACR, YchB/YabH family
Functional Class: S
The phylogenetic pattern of COG1947 is -----qvcebrhuj---li--
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 142-274 are 56% similar to a (KINASE ATP-BINDING TRANSFERASE CMK) protein domain (PD024009) which is seen in ISPE_HAEIN.

Residues 7-141 are 60% similar to a (KINASE TRANSFERASE ATP-BINDING) protein domain (PD008614) which is seen in ISPE_HAEIN.



Paralogs:  Local Blast Search
HD1628 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 85 to 248 (E-value = 1.4e-27) place HD1628 in the GHMP_kinases family which is described as GHMP kinases putative ATP-binding protein (PF00288)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNRIILPSPAKLNLFLYINGRRADGYHQLQTLFQFLDVGDEIDISITTSN
STIELVNDIAGVATEDNLIYRAAKLLQKKTACQQGAKIAVAKHLPMGGGV
GGGSSNAATVLVGLNYLWQTGLSLAQLAELGLSLGADVPIFVAGKTAFAE
GIGEILTPCELPEKWYLVLKPNISIETSSIFKDPKLPRNTPERSLSALLA
EDWGNDCEKVVREHYSEVEDLIQELLQYAPFRLTGTGACIFAEFASKAEA
EKVFNCRPHNMYGFVAKGQNISPLHKKLNLFS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAGAATAATTTTACCTAGTCCCGCTAAATTGAATCTTTTTTTATA
TATAAATGGACGAAGAGCAGATGGATATCATCAACTACAAACGCTTTTTC
AATTTCTAGATGTTGGTGATGAAATAGACATAAGTATAACAACGTCAAAT
TCCACAATTGAGTTAGTCAATGATATTGCAGGTGTTGCGACAGAAGATAA
TTTAATTTATCGTGCGGCTAAATTATTACAGAAAAAGACTGCTTGTCAGC
AAGGCGCTAAGATTGCAGTAGCTAAACATTTACCGATGGGCGGTGGCGTT
GGCGGTGGTTCTTCTAATGCGGCTACAGTATTGGTTGGACTTAATTATTT
ATGGCAGACAGGGCTTTCATTAGCACAATTGGCGGAATTAGGTTTATCTT
TAGGGGCGGATGTGCCGATTTTTGTGGCAGGTAAGACAGCTTTTGCAGAA
GGTATCGGTGAGATTCTGACGCCTTGCGAATTACCAGAAAAATGGTATCT
AGTATTAAAACCAAATATTTCAATTGAAACGTCTTCGATTTTTAAAGATC
CGAAGTTACCACGCAATACACCCGAGCGTAGCTTGTCAGCATTATTAGCA
GAAGATTGGGGAAACGATTGCGAAAAAGTTGTGAGGGAACATTATTCAGA
GGTTGAAGATCTTATTCAAGAATTGTTACAATATGCACCGTTTCGCTTGA
CGGGTACAGGTGCTTGTATTTTTGCTGAATTTGCTTCGAAAGCAGAAGCT
GAAAAAGTCTTTAATTGTAGACCTCATAATATGTACGGTTTTGTTGCAAA
AGGGCAAAATATTTCTCCGTTACATAAAAAATTAAACTTATTTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy