Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1187 IGR1190 IGR1184 IGR1186 IGR1189 IGR1185 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 cafA, - HD1631 aceF,acoC, - HD1624 msbA,lktB,cvaB, - HD1630 aceE, - HD1625 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 cafA, - HD1631 aceF,acoC, - HD1624 msbA,lktB,cvaB, - HD1630 aceE, - HD1625 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 cafA, - HD1631 aceF,acoC, - HD1624 msbA,lktB,cvaB, - HD1630 aceE, - HD1625
* Calculated from Protein Sequence

Gene ID: HD1627

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
prsA  

Definition:
ribose-phosphate pyrophosphokinase (phosphoribosylpyrophosphate synthase)

Gene Start:
1348838

Gene Stop:
1347888

Gene Length:
951

Molecular Weight*:
34322

pI*:
5.10

Net Charge*:
-5.40

EC:
2.7.6.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Pentose phosphate cycle
Purine metabolism

Secondary Evidence:
Hyyrylainen HL, Bolhuis A, Darmon E, Muukkonen L, Koski P, Vitikainen M, Sarvas M, Pragai Z, Bron S, van Dijl JM,
Kontinen VP.
A novel two-component regulatory system in Bacillus subtilis for the survival of severe secretion stress.
Mol Microbiol. 2001 Sep;41(5):1159-72.
PMID: 11555295

He B, Choi KY, Zalkin H.
Regulation of Escherichia coli glnB, prsA, and speA by the purine repressor.
J Bacteriol. 1993 Jun;175(11):3598-606.
PMID: 8388874

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits to from ribose-phosphate pyrophosphokinases from H. influenzae (1170693), E. coli (2506803), S. typhimurium (1170694), among others.

HD1627 is similar to ribose-phosphate pyrophosphokinases from M. pneumoniae (MP0082), M. genitalium (MG058), U. urealyticum (UU193), and T. pallidum (TP0294). No similarity to proteins from C. trachomatis or C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0462
COG name: Phosphoribosylpyrophosphate synthetase
Functional Class:  F,E
The phylogenetic pattern of COG0462 is AmtkYqvcebrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000842 (Phosphoribosyl pyrophosphate synthetase) with a combined E-value of 2.9e-163.
    IPB000842A    34-76
    IPB000842B    105-150
    IPB000842C    164-191
    IPB000842D    193-247
    IPB000842E    250-277
    IPB000842F    291-314


ProDom Summary:  Protein Domain Search
Residues 35-212 are 31% similar to a (PROTEOME PHOSPHORIBOSYL TRANSFERASE) protein domain (PD102473) which is seen in O83317_TREPA.

Residues 4-216 are 92% similar to a (TRANSFERASE PYROPHOSPHOKINASE RIBOSE-PHOSPHATE) protein domain (PD001439) which is seen in Q9CP22_PASMU.

Residues 1-215 are 44% similar to a (TRANSFERASE PHOSPHORIBOSYLPYROPHOSPHATE) protein domain (PD035825) which is seen in Q9VT33_DROME.

Residues 218-276 are 91% similar to a (PYROPHOSPHOKINASE RIBOSE-PHOSPHATE) protein domain (PD375317) which is seen in Q9CP22_PASMU.

Residues 217-277 are 81% similar to a (TRANSFERASE SYNTHETASE PHOSPHORIBOSYL PYROPHOSPHOKINASE) protein domain (PD016748) which is seen in KPRS_BUCAI.

Residues 278-314 are 91% similar to a (TRANSFERASE PYROPHOSPHOKINASE RIBOSE-PHOSPHATE) protein domain (PD252859) which is seen in Q9CP22_PASMU.



Paralogs:  Local Blast Search

HD1627 is paralogously related to HD1178 (6e-04).


Pfam Summary:  Pfam Search
Residues 140 to 272 (E-value = 8.2e-34) place HD1627 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:
pdb|1DKR|B Chain B, Crystal Structures Of Bacillus Subtilis Pho... 303 2e-083

Gene Protein Sequence:
MPDIKLFAGNATPELAKRISERLYISLGNATVGRFSDGEIQVQINENVRG
SDVFIIQSTCAPTNDNLMELIVMVDALRRASAGRITAVIPYFGYSRQDRR
VRSARVPITAKVVADFLSSVGVDRVLTCDLHAEQIQGFFDVPVDNVFGSP
VLIDDILKKKDLVNPIVVSPDIGGVVRARAVAKLLNDTDMAIIDKRRPKA
NVSQVMHIIGDVTDRDCILVDDMIDTGGTLVKAAEALKERGARRVFAYAT
HAVFSGSAANNLANPALDEVVVTDTIPLSDEIEALNKVRVLTLSSMLAEA
IRRISNEESISAMFDA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAGATATTAAACTGTTTGCGGGTAACGCAACACCAGAACTTGCAAA
ACGTATTTCAGAACGCCTTTATATTTCTTTAGGAAATGCAACAGTAGGGC
GTTTTAGTGATGGTGAAATTCAAGTACAAATTAATGAAAATGTGCGCGGT
TCAGATGTATTTATTATCCAATCAACTTGTGCCCCCACTAATGATAATTT
AATGGAATTGATCGTGATGGTTGACGCGTTACGCCGTGCTTCAGCGGGGC
GGATTACTGCTGTGATACCTTACTTTGGTTATTCTCGTCAAGATCGTCGT
GTTCGTTCAGCGCGTGTACCCATTACGGCTAAAGTAGTCGCAGACTTTCT
TTCTAGTGTAGGTGTTGATCGTGTATTAACCTGTGATTTGCACGCAGAAC
AAATTCAAGGTTTCTTTGATGTACCTGTTGACAATGTTTTTGGTTCGCCT
GTATTAATTGATGATATTCTTAAGAAAAAAGATTTGGTAAATCCAATCGT
GGTGTCACCAGATATTGGCGGGGTAGTACGTGCACGTGCTGTGGCTAAAT
TGTTAAATGATACTGATATGGCGATTATTGATAAACGTCGGCCTAAAGCG
AATGTTTCGCAAGTGATGCATATTATTGGTGATGTAACCGATCGTGATTG
TATTCTAGTCGATGATATGATTGATACCGGTGGTACTTTAGTTAAAGCAG
CCGAAGCGTTAAAAGAGCGCGGTGCTCGTCGAGTATTTGCTTATGCAACG
CATGCAGTTTTTTCTGGCTCCGCAGCTAATAATTTAGCTAATCCAGCACT
TGATGAAGTGGTTGTAACCGATACTATTCCATTATCTGATGAAATTGAGG
CATTAAATAAAGTACGCGTATTAACGTTATCAAGCATGCTTGCTGAAGCG
ATTCGCCGAATTAGCAATGAAGAATCTATTTCGGCAATGTTTGATGCATA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy