Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1187 IGR1190 IGR1184 IGR1186 IGR1189 IGR1185 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 aceF,acoC, - HD1624 msbA,lktB,cvaB, - HD1630 aceE, - HD1625 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 aceF,acoC, - HD1624 msbA,lktB,cvaB, - HD1630 aceE, - HD1625 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 aceF,acoC, - HD1624 msbA,lktB,cvaB, - HD1630 aceE, - HD1625
* Calculated from Protein Sequence

Gene ID: HD1626

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pyrD  

Definition:
dihydroorotate dehydrogenase

Gene Start:
1347769

Gene Stop:
1346762

Gene Length:
1008

Molecular Weight*:
36423

pI*:
9.00

Net Charge*:
5.32

EC:
1.3.3.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Li X, Weinstock GM, Murray BE.
Generation of auxotrophic mutants of Enterococcus faecalis.
J Bacteriol. 1995 Dec;177(23):6866-73.
PMID: 7592480

Frick,M.M., Neuhard,J. and Kelln,R.A.
Cloning, nucleotide sequence and regulation of the Salmonella typhimurium pyrD gene encoding dihydroorotate dehydrogenase.
Eur. J. Biochem. 194(2): 573-578, 1990.
Medline: 91099333.

Larsen,J.N. and Jensen,K.F.
Nucleotide sequence of the pyrD gene of Escherichia coli and characterization of the flavoprotein dihydroorotate dehydrogenase. Eur. J. Biochem. 151(1): 59-65, 1985.
Medline: 85285014.


Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to dihydroorotate dehydrogenases from H. influenzae (1172786), E. coli (131721), S. typhimurium (585766), among others.

No similarity to proteins from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0167
COG name: Dihydroorotate dehydrogenase
Functional Class:  F
The phylogenetic pattern of COG0167 is amtkyqvCEbrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001295 (Dihydroorotate dehydrogenase) with a combined E-value of 4.6e-65.
    IPB001295A    47-58
    IPB001295B    74-97
    IPB001295C    106-115
    IPB001295D    162-176
    IPB001295E    209-219
    IPB001295F    226-244
    IPB001295G    257-270
    IPB001295H    286-316
    IPB001295G    260-273


ProDom Summary:  Protein Domain Search
Residues 155-308 are 60% similar to a (DIHYDROOROTATE DEHYDROGENASE) protein domain (PD123513) which is seen in PYRD_HAEIN.

Residues 48-332 are 61% similar to a (DIHYDROOROTATE DEHYDROGENASE OXIDOREDUCTASE FLAVOPROTEIN) protein domain (PD001761) which is seen in Q9KRZ2_VIBCH.

Residues 82-151 are 75% similar to a (DIHYDROOROTATE DEHYDROGENASE) protein domain (PD123507) which is seen in PYRD_PASMU.

Residues 43-81 are 66% similar to a (DIHYDROOROTATE DEHYDROGENASE) protein domain (PD123516) which is seen in PYRD_ARATH.

Residues 13-81 are 50% similar to a (DIHYDROOROTATE DEHYDROGENASE FAD) protein domain (PD123509) which is seen in PYRD_RAT.

Residues 162-315 are 48% similar to a (DIHYDROOROTATE DEHYDROGENASE) protein domain (PD415821) which is seen in Q9HZF8_PSEAE.

Residues 1-75 are 60% similar to a (DIHYDROOROTATE DEHYDROGENASE PROTEOME) protein domain (PD166805) which is seen in PYRD_PASMU.

Residues 1-81 are 38% similar to a (DEHYDROGENASE DIHYDROOROTATE) protein domain (PD254681) which is seen in Q9KXR7_STRCO.

Residues 2-81 are 55% similar to a (DIHYDROOROTATE FMN DHOD PYRIMIDINE) protein domain (PD166374) which is seen in PYRD_HAEIN.



Paralogs:  Local Blast Search

HD1626 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 42 to 334 (E-value = 3e-130) place HD1626 in the DHO_dh family which is described as Dihydroorotate dehydrogenase (PF01180)

PDB Hit:
pdb|1D3G|A Chain A, Human Dihydroorotate Dehydrogenase Complexe... 233 3e-062
pdb|1EP1|A Chain A, Crystal Structure Of Lactococcus Lactis Dih... 65 1e-011

Gene Protein Sequence:
MYSLIRKALFSMEAETAHYFSIQALKLMGKLPFSLCSTTLNPVEVMGLKF
KNPIGLAAGADKNGEAIDGFAKLGFGFIEVGTVTPLAQDGNNKPRQFRIL
EAEGIINRNGFNNQGVDVLVENVKKASYDGILGINIGKNATTPIENALDD
YQICLHKVYSYADYITVNISSPNTHNLRALQYGEALDHLLAELKTEQAKL
AKKFNQYKPLVLKIAPDLTNEEIVSIADSLIRHQMDGVIAGNTTLSRENI
AGFNHAHQQGGLSGKPLHTLSTKLISTLAKELKGKIPIIGSGGVHSIDSG
QQKIDAGAHLLQLYSAMIYQGPTLIQELAKKIILR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTCTTTGATTCGAAAAGCATTGTTTTCAATGGAAGCAGAAACAGC
ACACTATTTTTCTATTCAAGCATTAAAACTGATGGGTAAATTACCTTTTA
GTTTATGTTCAACAACGCTAAATCCTGTAGAGGTCATGGGATTGAAATTT
AAAAATCCTATTGGTCTAGCCGCAGGTGCAGATAAAAATGGTGAAGCAAT
AGATGGCTTTGCTAAATTAGGATTTGGCTTTATCGAGGTTGGCACAGTCA
CGCCTTTAGCCCAAGATGGTAATAATAAGCCACGTCAGTTTCGTATTTTG
GAAGCAGAAGGAATCATTAACCGAAATGGCTTTAATAATCAAGGTGTTGA
TGTATTAGTAGAGAACGTGAAAAAGGCTAGTTATGATGGTATTTTAGGTA
TTAATATCGGTAAAAATGCAACTACACCGATTGAAAATGCATTAGATGAT
TATCAAATTTGTTTGCATAAAGTCTATTCATATGCCGATTACATTACGGT
CAATATTTCTTCGCCCAATACGCATAATCTGCGCGCTTTACAGTATGGTG
AAGCACTCGATCATTTGTTAGCTGAACTTAAAACAGAGCAAGCAAAATTG
GCAAAAAAATTTAATCAATATAAACCGCTTGTCTTAAAAATTGCGCCTGA
TTTAACCAATGAAGAAATCGTTTCGATTGCCGATAGTCTTATTCGGCATC
AAATGGACGGTGTAATCGCAGGAAATACAACGCTTTCTCGTGAAAATATT
GCGGGATTTAATCATGCTCATCAACAAGGCGGATTAAGCGGTAAACCATT
GCATACATTGAGCACGAAATTAATCAGTACGTTAGCAAAAGAATTAAAAG
GAAAAATACCTATTATTGGCAGTGGTGGTGTTCATTCTATTGATTCTGGA
CAACAAAAAATAGATGCGGGTGCTCATTTATTGCAATTATATTCAGCAAT
GATTTATCAAGGACCAACCTTGATCCAAGAATTAGCTAAAAAGATTATCT
TAAGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy