Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 tRNA-Gly-4 IGR1187 IGR1183 IGR1184 IGR1186 IGR1185 IGR1182 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 lpdA, - HD1623 aceF,acoC, - HD1624 aceE, - HD1625 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 lpdA, - HD1623 aceF,acoC, - HD1624 aceE, - HD1625 lolB, - HD1629 ispE, - HD1628 prsA, - HD1627 pyrD, - HD1626 lpdA, - HD1623 aceF,acoC, - HD1624 aceE, - HD1625
* Calculated from Protein Sequence

Gene ID: HD1625

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aceE  

Definition:
pyruvate dehydrogenase multienzyme complex E1

Gene Start:
1346423

Gene Stop:
1343766

Gene Length:
2658

Molecular Weight*:
99018

pI*:
5.60

Net Charge*:
-18.54

EC:
1.2.4.1  1.2.4.2  

Functional Class:
Energy metabolism; Pyruvate dehydrogenase  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)
Carbohydrate Metabolism; Pyruvate metabolism

Secondary Evidence:
Quail MA, Haydon DJ, Guest JR.
The pdhR-aceEF-lpd operon of Escherichia coli expresses the pyruvate dehydrogenase complex.
Mol Microbiol. 1994 Apr;12(1):95-104.
PMID: 8057842

Spencer ME, Guest JR.
Transcription analysis of the sucAB, aceEF and lpd genes of Escherichia coli.
Mol Gen Genet. 1985;200(1):145-54.
PMID: 3897791

Comment:
A regulator for the ace operon, pdhR, has not been found.

Blast Summary:  PSI-Blast Search
Several significant hits to pyruvate dehydrogenase, E1 components from H. influenzae (gi:), E. coli (gi:),

HD1625 is similar to a predicted transketolase I from U. urealyticum (UU586), C. trachomatis (CT750), C. pneumoniae (CPn0893) and M. pneumoniae (MP0073). No similarity to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0021
COG name: Transketolase
Functional Class:  G
The phylogenetic pattern of COG0021 is -m--YqVCEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000360 (Transketolase) with a combined E-value of 4.2e-16.
    IPB000360A    104-115
    IPB000360B    577-616
    IPB000360C    630-659


ProDom Summary:  Protein Domain Search
Residues 361-421 are 95% similar to a (SYNTHASE THIAMINE DEHYDROGENASE PYROPHOSPHATE PYRUVATE) protein domain (PD000580) which is seen in ODP1_HAEIN.

Residues 7-78 are 69% similar to a (PYRUVATE DEHYDROGENASE COMPONENT E1) protein domain (PD008560) which is seen in ODP1_HAEIN.

Residues 292-353 are 93% similar to a (PYRUVATE DEHYDROGENASE COMPONENT E1) protein domain (PD009824) which is seen in ODP1_HAEIN.



Paralogs:  Local Blast Search
HD1625 is paralogously related to HD1723 (4e-07).


Pfam Summary:  Pfam Search
Residues 76 to 356 (E-value = 2.8e-07) place HD1625 in the Transketolase_N family which is described as Transketolase, thiamine diphosphate binding domain (PF00456)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSELERDVDPFETKEWLESLDSLIRVEGAERAQFIIDELLNQARAEGVPV
QSGVTTAYVNTIPVSAQPAYPGDHAIERRIRSAVRWNAIAMVLRSQKKDL
DLGGHISTFQSAATMYEVCYNHFFKAATDKNGGDLIFSQGHAAPGIYARA
FLEGRLSEQQMDNFRQEAFTDGLSSYPHPKLMPEFWQFSTVSMGLGPVNA
IYQARFLKYLENRGLKDTADQKVYAFLGDGEMDEIESKGALTFAAREKLD
NLIFTISCNLQRLDGPVNGNGKIIQELEGLFVGAGWEVIKVLWGSNWDKL
FAKDTSGKLTQLMMEVLDGDYLTFKSKNGAYIREHFFGRYPETAALVADM
SDDEIWELRRGAHDSEKLYAAYAKAQHATKPVVILAHQVKGYKIPEAESK
NTAHQSKKMSYDSLKGFRDYFELPLTDEQVENLEYIKFAEGSAEYEYLHA
HRKALNGYVPARRKAFNIDYQVPALEEFQALLEAQPRGISTTMAFSRVLN
TLLKNKNIGKTIVPIIADEARTFGMEGLFRQIGIYNPHGQNYVPSDRDLV
AYYREAKDGQVLQEGINELGATSSWVAAATSYSVSNQPMIPFFIYYSMFG
FQRVGDMMWLAGDQLARGFMIGGTSGRTTLNGEGLQHEDGHSHIQASVIP
NCVTYDPSFAFEVAVIVQDGINRMYGEKQEDVFYYITTLNEVTEQPAMPS
GAEEGIRKGLYKFETVEGKKGKGHVQLLGSGAIMRHVREAAQILAKEYGI
TSDVFSAPSFNELGRDGADCARWNLLHLTEAPRVPYVGQVLADLPTVAST
DYMKLYAEQIRAYVPTRHYHVLGTDGFGRSDSRANLREHFEINEHYVVVA
ALAQLAKEGSVDAKVVEEAIKKFGLNVDRINPLYA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGAGTTAGAAAGAGATGTAGACCCATTTGAAACAAAAGAGTGGCT
TGAATCATTAGACTCATTAATTCGAGTTGAAGGTGCTGAACGTGCACAGT
TTATTATTGATGAATTATTAAATCAAGCTCGTGCGGAAGGCGTGCCTGTT
CAATCAGGTGTAACAACAGCATACGTAAATACGATCCCTGTATCGGCACA
ACCTGCTTATCCAGGCGATCACGCGATAGAACGTCGTATTCGTTCGGCTG
TTCGCTGGAATGCTATTGCAATGGTTTTACGTAGTCAGAAAAAAGATCTT
GATTTAGGCGGTCATATTTCAACATTCCAATCTGCAGCAACAATGTATGA
AGTTTGTTATAATCACTTTTTCAAAGCAGCAACAGATAAAAATGGTGGTG
ATTTAATTTTTTCACAAGGTCATGCTGCACCTGGTATCTATGCTCGTGCT
TTCTTAGAAGGTCGCCTTAGTGAACAACAAATGGATAATTTCCGTCAAGA
AGCATTCACTGATGGTTTATCTTCATATCCACATCCAAAACTAATGCCTG
AATTTTGGCAATTCTCAACGGTATCAATGGGATTAGGCCCTGTTAATGCA
ATTTACCAAGCACGTTTCTTAAAATATCTTGAAAACCGTGGTTTAAAAGA
CACGGCAGATCAAAAAGTTTATGCATTCTTAGGCGATGGTGAAATGGACG
AAATTGAGTCTAAAGGCGCATTAACTTTTGCAGCACGTGAGAAGTTAGAT
AACTTAATTTTTACAATCAGTTGTAACTTACAACGTTTAGATGGCCCAGT
TAATGGTAATGGTAAGATTATTCAAGAACTAGAAGGACTATTTGTTGGTG
CTGGTTGGGAAGTTATTAAAGTATTATGGGGAAGTAATTGGGATAAATTA
TTCGCAAAAGATACTTCAGGTAAGTTAACACAGTTAATGATGGAAGTATT
AGATGGTGATTATTTAACCTTTAAATCTAAAAATGGTGCTTACATTCGTG
AACATTTCTTCGGTCGTTATCCTGAAACAGCCGCATTAGTTGCAGATATG
TCTGATGATGAAATTTGGGAATTACGTCGTGGAGCACACGATAGTGAAAA
ACTTTATGCAGCATATGCTAAAGCGCAACATGCAACGAAACCTGTTGTTA
TCTTAGCTCATCAAGTAAAAGGCTATAAGATTCCAGAAGCAGAAAGTAAG
AATACGGCTCATCAATCGAAAAAAATGTCTTATGATAGCCTTAAAGGATT
CCGTGACTACTTTGAACTACCATTAACGGATGAACAAGTAGAAAATTTAG
AATATATTAAATTTGCAGAAGGCTCAGCGGAGTATGAATATTTACATGCT
CATCGTAAAGCCTTAAATGGTTATGTGCCAGCTCGTCGTAAAGCGTTTAA
TATTGATTATCAGGTGCCTGCATTAGAAGAATTCCAAGCATTATTAGAAG
CACAACCACGAGGTATATCAACCACTATGGCATTTAGTCGTGTGTTGAAT
ACATTATTAAAAAATAAAAATATTGGCAAAACAATTGTACCAATTATTGC
TGATGAAGCGCGTACTTTTGGTATGGAAGGTTTATTCCGTCAAATTGGTA
TTTATAATCCACATGGTCAAAACTATGTGCCTTCGGATCGAGATCTTGTT
GCTTACTACCGTGAAGCGAAAGATGGCCAAGTTTTACAAGAAGGTATTAA
TGAATTAGGTGCGACATCTTCTTGGGTCGCGGCAGCAACCTCTTATTCTG
TAAGTAACCAACCAATGATTCCTTTCTTCATTTATTATTCAATGTTTGGT
TTCCAACGCGTTGGCGATATGATGTGGTTAGCGGGCGACCAATTAGCTAG
AGGCTTTATGATCGGAGGTACTTCTGGTCGTACAACATTAAATGGTGAAG
GTTTACAGCATGAAGATGGTCACAGTCATATTCAAGCGAGCGTTATTCCG
AACTGTGTGACTTATGATCCATCATTTGCTTTTGAAGTTGCGGTTATTGT
ACAAGATGGTATTAACCGTATGTATGGTGAGAAACAAGAAGATGTATTCT
ATTACATTACCACTTTAAATGAAGTTACTGAACAGCCAGCAATGCCTAGC
GGTGCTGAAGAAGGCATCCGTAAAGGATTGTATAAATTTGAAACGGTTGA
AGGTAAGAAAGGCAAAGGCCATGTACAATTGTTAGGTTCTGGTGCAATTA
TGCGTCATGTTCGTGAAGCAGCACAAATTCTTGCCAAAGAGTATGGCATT
ACTTCAGATGTGTTCTCAGCACCTTCATTTAATGAATTAGGCCGTGATGG
CGCAGATTGTGCACGTTGGAATTTATTACATCTAACGGAGGCTCCACGAG
TTCCATATGTTGGTCAAGTATTAGCTGATTTACCAACGGTTGCATCAACG
GATTACATGAAATTATACGCAGAGCAAATCCGTGCTTATGTCCCAACTAG
ACACTATCATGTGTTAGGTACGGATGGCTTTGGTCGTTCTGATAGCCGTG
CAAATTTACGTGAACATTTTGAAATTAATGAACATTATGTTGTAGTTGCT
GCATTAGCACAACTAGCGAAAGAAGGCTCGGTAGATGCTAAAGTTGTTGA
AGAAGCAATCAAAAAATTCGGCTTAAACGTAGATCGTATTAATCCATTAT
ACGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy