Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1178 IGR1179 IGR1176 IGR1181 IGR1175 IGR1180 IGR1174 IGR1177 IGR1182 HD1610 HD1621 tpn, - HD1612 HD1619 lepA, - HD1608 HD1615 HD1609 HD1617 HD1614 HD1618 tpn, - HD1616 HD1610 HD1621 tpn, - HD1612 HD1619 lepA, - HD1608 HD1615 HD1609 HD1617 HD1614 HD1618 tpn, - HD1616 HD1621 tpn, - HD1612 HD1619 lepA, - HD1608 HD1611 HD1622 HD1622 HD1610 HD1611 HD1609 HD1618 tpn, - HD1616 HD1613 HD1614 HD1617 HD1613 HD1615
* Calculated from Protein Sequence

Gene ID: HD1616

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
transposase

Gene Start:
1334296

Gene Stop:
1335360

Gene Length:
1065

Molecular Weight*:
41175

pI*:
10.50

Net Charge*:
28.42

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Secondary Evidence:
Dobson,S.R., Kroll,J.S. and Moxon,E.R.
Insertion sequence IS1016 and absence of Haemophilus capsulation
genes in the Brazilian purpuric fever clone of Haemophilus
influenzae biogroup aegyptius
Infect. Immun. 60 (2), 618-622 (1992)
Medline: 92112329


Comment:


Blast Summary:  PSI-Blast Search
Residues 1-336 are 37% similar to 21243959 transposase [Xanthomonas axonopodis pv. citri str. 306].

A few weak hits using gapped BLAST to putative transposases from
Xanthomonas pv. mangiferaeindicae (7637750), Halobacterium sp. (7484109), and a hypothetical protein from Pseudomonas stutzeri (5701905).

No similarity to proteins from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 24-149 are 32% similar to a (MEMBRANE OUTER TRANSPOSASE TBUX) protein domain (PD039757) which is seen in Q9L792_BBBBB.



Paralogs:  Local Blast Search
HD1616 is paralogously related to HD1689 (1e-155), HD1612 (9e-80), HD0295 (2e-37), HD1695 (1e-36), HD0291 (1e-36), HD1696 (4e-33) and HD0290 (4e-33).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAQHFRLSTAARQLSSDSLVCLPDAEIFQRLKQARWGNADNFVCPHCHIR
HLAYFISTRKQWQCKHCQHRFSITAGTIFQGAKLPLRKILLAILYFATES
KGLSAIALSHKLNVQYKTAWVLLHKFRESLDKAKDLTPLNGEVHIDGAYT
NYYIRPKNFRHKRIDRRKKRYQRADKSCVLVFRQRAANQAVMKGADRSIV
ALVKEENTKDVLELTQRLVKPNSTIHADENPAYDCLAFHYDLWRVNHSQE
YRSIEGITNNLAESFFARLRRAITGIYHKMSNKYLMYYANEMVWREDHRR
KSVKEKFEQLLTCCLNTLPSRDFTGYWQGNKKGEAVFGLASLTASNDLHY
LKAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACAGCATTTTCGGTTATCAACGGCAGCACGCCAGCTATCTTCGGA
TAGTTTGGTGTGTTTGCCTGATGCCGAGATTTTTCAGCGATTAAAACAAG
CTCGCTGGGGTAATGCGGATAATTTTGTTTGTCCGCATTGCCATATCCGC
CACCTAGCTTACTTCATTTCCACTCGCAAACAATGGCAATGCAAGCATTG
TCAGCACCGTTTTTCCATTACCGCAGGTACGATTTTTCAAGGGGCAAAAC
TGCCTTTGCGTAAAATTCTCCTCGCCATTCTTTATTTTGCGACTGAAAGC
AAAGGGTTATCCGCCATTGCCTTATCACACAAACTCAATGTGCAATATAA
AACAGCGTGGGTACTGCTACATAAATTCCGTGAATCACTCGATAAAGCCA
AAGATTTAACACCGCTCAACGGTGAGGTACATATTGATGGTGCATATACC
AATTATTACATTCGCCCTAAAAACTTCCGCCACAAACGCATTGATAGACG
GAAGAAACGCTATCAGCGTGCGGATAAGTCTTGTGTGTTGGTATTCCGCC
AACGTGCGGCAAATCAAGCCGTAATGAAAGGGGCTGACCGTAGTATTGTC
GCTTTAGTGAAAGAAGAAAATACAAAAGATGTGCTTGAACTTACGCAACG
CTTAGTCAAGCCGAACAGCACTATTCATGCTGATGAAAACCCAGCTTATG
ATTGTCTTGCCTTCCATTATGACTTATGGCGAGTCAATCATTCGCAGGAA
TATCGTTCGATTGAGGGGATTACAAACAACCTTGCTGAGTCCTTTTTCGC
ACGGCTACGGCGAGCCATTACAGGTATCTACCACAAAATGAGCAATAAAT
ATCTGATGTACTATGCGAACGAAATGGTATGGCGAGAAGATCATCGTAGA
AAAAGCGTAAAAGAGAAATTTGAGCAACTCTTAACCTGTTGCTTAAATAC
TTTGCCGTCACGAGATTTTACAGGGTATTGGCAAGGCAATAAAAAAGGCG
AAGCGGTATTTGGTTTGGCAAGCCTGACGGCTTCAAACGATCTACACTAC
TTAAAAGCAGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy