Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1178 IGR1179 IGR1176 IGR1173 IGR1181 IGR1175 IGR1180 IGR1174 IGR1177 HD1610 lepB, - HD1607 HD1621 tpn, - HD1612 HD1619 lepA, - HD1608 HD1615 HD1609 HD1617 HD1614 HD1618 tpn, - HD1616 HD1610 lepB, - HD1607 HD1621 tpn, - HD1612 HD1619 lepA, - HD1608 HD1615 HD1609 HD1617 HD1614 HD1618 tpn, - HD1616 lepB, - HD1607 HD1621 tpn, - HD1612 HD1619 lepA, - HD1608 HD1611 HD1610 HD1611 HD1609 HD1618 tpn, - HD1616 HD1613 HD1614 HD1617 HD1613 HD1615
* Calculated from Protein Sequence

Gene ID: HD1614

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
possible prophage ps3 protein 01

Gene Start:
1333197

Gene Stop:
1333595

Gene Length:
399

Molecular Weight*:
15538

pI*:
8.40

Net Charge*:
1.42

EC:
 

Functional Class:
Other categories; Phage-related functions and prophages  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 31-126 are 41% similar to 19551563 uncharacterized phage-associated protein [Corynebacterium glutamicum ATCC 13032].

Two weak hits using gapped BLAST to hypothetical protein from U. urealyticum (6898980) and Dichelobacter nodosus (1628368).

HD1617 is similar to a predicted hypothetical protein from U. urealyticum (UU033). No similarity to proteins from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 35-126 are 38% similar to a (PROTEOME COMPLETE UU033 REGA) protein domain (PD092804) which is seen in Q9PRB2_UREPA.



Paralogs:  Local Blast Search
HD1614 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LQFLLKKFLKRNKYINYFLSQCNSEENGDLISNLKIQKLVYYAQGFSLAI
NNKPLFSEKIQAWTHGPVTPELYNKYKQYGNGALPTTDLDIDFDKFSNEE
KDLLNDINDVYGQFSAWKLRNMTHEEKYIPTR$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAATTTCTTTTAAAGAAATTTCTGAAAAGAAATAAGTATATCAACTA
TTTTTTATCGCAATGTAATAGTGAAGAAAACGGTGATTTAATTTCTAATT
TAAAGATCCAAAAATTAGTTTATTATGCGCAAGGTTTTTCTTTAGCCATA
AATAATAAACCTCTTTTCTCTGAAAAAATTCAAGCTTGGACTCATGGTCC
TGTAACTCCTGAACTGTATAATAAATACAAACAATATGGAAACGGAGCTT
TACCAACAACTGATTTAGATATAGACTTTGATAAATTTTCTAATGAAGAA
AAAGACCTACTTAATGATATTAATGATGTTTATGGTCAGTTTTCTGCTTG
GAAATTAAGAAATATGACTCATGAAGAGAAGTACATACCAACAAGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy