Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1172 IGR1178 IGR1179 IGR1176 IGR1173 IGR1175 IGR1180 IGR1174 IGR1177 HD1610 rnc, - HD1606 lepB, - HD1607 tpn, - HD1612 HD1619 lepA, - HD1608 HD1615 HD1609 HD1617 HD1614 HD1618 tpn, - HD1616 HD1610 rnc, - HD1606 lepB, - HD1607 tpn, - HD1612 HD1619 lepA, - HD1608 HD1615 HD1609 HD1617 HD1614 HD1618 tpn, - HD1616 rnc, - HD1606 lepB, - HD1607 tpn, - HD1612 HD1619 lepA, - HD1608 HD1611 HD1610 HD1611 HD1609 HD1618 tpn, - HD1616 HD1613 HD1614 HD1617 HD1613 HD1615
* Calculated from Protein Sequence

Gene ID: HD1612

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
transposase

Gene Start:
1332789

Gene Stop:
1331752

Gene Length:
1038

Molecular Weight*:
40405

pI*:
9.90

Net Charge*:
17.44

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1-343 are 33% similar to 21109571 transposase [Xanthomonas axonopodis pv. citri str. 306].

Few weak hits using gapped BLAST to putative transposases from Xanthomonas pv. mangiferaeindicae (7637750), Halobacterium sp. (7484109), and a hypothetical protein from Pseudomonas stutzeri (5701905).

No similarity to proteins from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 23-185 are 23% similar to a (MEMBRANE OUTER TRANSPOSASE TBUX) protein domain (PD039757) which is seen in Q9L792_BBBBB.



Paralogs:  Local Blast Search
HD1612 is paralogously related to HD1696 (4e-97), HD0290 (4e-97), HD1616 (9e-80), HD1689 (3e-74), HD1695 (2e-73), HD0291 (2e-73) and HD0295 (8e-24).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAQHFLLTQKAKTLSAFEIANISEAEAFDLLCEARWGSKENVVCSKCGVQ
HKAYFISIRKQWRCKHCHHTFSVTSGTIFANHKLPLKTYLYILIRFVNAV
KGVSALEISRDAKINYRTAFVLCHKLRKALLESRDMQPLSGEVDMGGTYI
HPAPRKANKKADRIDYRLKENQNPNKRCVVVAREHFSADEKAENSLYRGA
KRSHVFVTYSETQSVVKNFAHAYIEKNSRINTDENTAYESLLLDYDLRTV
NHKDEYRSDFGVTNNQAESFFSRFKRMYYGHVHKMSNTYLLNYANEIAYR
EDNRRKPNGWQFHDILGKCLETTNEQNEWCGYWQRKIFHQEVIWQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACAACATTTTTTACTCACCCAGAAAGCCAAAACGCTTTCTGCTTT
TGAGATAGCCAATATCTCAGAAGCGGAAGCGTTTGACTTGCTCTGCGAAG
CTCGTTGGGGGAGTAAGGAAAATGTGGTGTGTTCGAAATGCGGTGTTCAG
CATAAAGCCTATTTCATTTCTATTCGTAAGCAATGGCGTTGCAAGCACTG
TCATCATACTTTTTCAGTCACATCAGGCACGATTTTTGCGAATCATAAGT
TACCGTTGAAAACCTATCTGTACATTTTGATTCGTTTTGTGAATGCGGTT
AAGGGTGTCTCTGCCCTAGAAATCTCTCGTGATGCGAAAATCAACTATCG
CACCGCCTTTGTGCTTTGTCATAAATTGCGTAAAGCCTTGCTAGAGAGTC
GAGATATGCAACCACTTTCAGGCGAAGTGGATATGGGCGGCACTTACATT
CATCCTGCACCTCGTAAAGCAAATAAGAAAGCCGACCGCATTGATTACCG
CTTAAAAGAAAATCAAAATCCAAATAAGCGTTGCGTGGTAGTCGCTCGTG
AGCATTTTTCTGCGGATGAAAAAGCGGAAAATTCACTTTATCGTGGGGCA
AAGCGTTCGCACGTGTTCGTGACGTATTCTGAAACCCAGTCGGTAGTGAA
AAATTTCGCTCACGCTTACATTGAGAAAAACAGCCGTATCAATACGGACG
AAAACACCGCTTACGAAAGTTTGTTACTCGACTATGATTTACGCACCGTA
AATCATAAAGACGAATACCGTAGTGATTTTGGCGTAACCAACAATCAAGC
TGAATCCTTTTTCTCTCGTTTTAAACGGATGTACTACGGACACGTGCATA
AAATGAGCAACACCTATTTACTCAACTATGCCAACGAAATTGCGTACCGT
GAAGATAATCGCCGTAAACCGAATGGCTGGCAGTTCCACGATATTTTAGG
CAAATGCCTTGAAACCACCAACGAACAAAACGAATGGTGTGGTTACTGGC
AACGGAAAATCTTTCATCAGGAAGTCATTTGGCAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy