Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1167 IGR1172 IGR1170 IGR1171 IGR1173 IGR1168 IGR1175 IGR1169 IGR1174 HD1610 rhlB, - HD1602 rnc, - HD1606 recO, - HD1604 deaD, - HD1603 era, - HD1605 lepB, - HD1607 tpn, - HD1612 HD1601 lepA, - HD1608 HD1609 HD1614 HD1610 rhlB, - HD1602 rnc, - HD1606 recO, - HD1604 deaD, - HD1603 era, - HD1605 lepB, - HD1607 tpn, - HD1612 HD1601 lepA, - HD1608 HD1609 HD1614 rhlB, - HD1602 rnc, - HD1606 recO, - HD1604 deaD, - HD1603 era, - HD1605 lepB, - HD1607 tpn, - HD1612 HD1601 lepA, - HD1608 HD1611 HD1610 HD1611 HD1609 HD1613 HD1614 HD1613
* Calculated from Protein Sequence

Gene ID: HD1607

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lepB  

Definition:
signal peptidase I (SPase I)

Gene Start:
1328807

Gene Stop:
1327842

Gene Length:
966

Molecular Weight*:
36717

pI*:
7.70

Net Charge*:
1.41

EC:
3.4.21.89  3.4.99.36  

Functional Class:
Cellular processes; Protein and peptide secretion  

Pathway: pathway table
Protein export

Secondary Evidence:
Black,M.T.
Evidence that the catalytic activity of prokaryote leader peptidase depends upon the operation
of a serine-lysine catalytic dyad.
J. Bacteriol. 175(16): 4957-4961, 1993.
Medline: 93352398.

Black,M.T., Munn,J.G. and Allsop,A.E.
On the catalytic mechanism of prokaryotic leader peptidase 1. Biochem. J. 282(Pt 2): 539-543,
1992.
Medline: 92189595.

Paetzel,M., Dalbey,R.E. and Strynadka,N.C.
Crystal structure of a bacterial signal peptidase in complex with a beta-lactam inhibitor
Nature 396 (6707), 186-190 (1998)
MEDLINE: 99039507


Sung,M. and Dalbey,R.E.
Identification of potential active-site residues in the
Escherichia coli leader peptidase.
J. Biol. Chem. 267(19): 13154-13159, 1992.
Medline: 92317021.

Bilgin,N., Lee,J.I., Zhu,H.Y., Dalbey,R. and von Heijne,G.
Mapping of catalytically important domains in Escherichia coli leader peptidase.
EMBO J. 9(9): 2717-2722, 1990.
Medline: 90360981.

van Dijl JM, van den Bergh R, Reversma T, Smith H, Bron S, Venema
G.
Molecular cloning of the Salmonella typhimurium lep gene
in Escherichia coli.
Mol. Gen. Genet. 223 (2), 233-240, 1990.
Medline: 2250650.

Wolfe PB, Wickner W, Goodman JM.
Sequence of the leader
peptidase gene of Escherichia coli and the orientation of leader
peptidase in the bacterial envelope.
J. Biol. Chem. 258 (19) 12073-12080,, 1983.
Medline: 6311837.

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous signifant hits using gapped BLAST to signal peptidase I proteins from H. influenzae (1170766), E. coli (2506809), S. typhimurium (126189), among others.

HD1607 is similar to predicted signal peptidase I proteins from C. trachomatis (CT020), C. pneumoniae (CPn0110), and T. pallidum (TP0926). No similarity to M. genitalium or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0681
COG name: Signal peptidase I
Functional Class:  N
The phylogenetic pattern of COG0681 is AmTKYqvCeBrhuj--OLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000508 (Signal peptidase) with a combined E-value of 4.4e-47.
    IPB000508A    100-130
    IPB000508B    150-161
    IPB000508C    170-180
    IPB000508D    260-279


ProDom Summary:  Protein Domain Search
Residues 260-293 are 91% similar to a (I PEPTIDASE SIGNAL PROTEASE) protein domain (PD001438) which is seen in Q9KPB1_VIBCH.

Residues 88-183 are 27% similar to a (I PROTEOME COMPLETE PXO2-59) protein domain (PD280421) which is seen in Q9X1Q8_THEMA.

Residues 257-316 are 54% similar to a (I PEPTIDASE SIGNAL LEADER) protein domain (PD204547) which is seen in LEP_PSEAE.

Residues 88-136 are 75% similar to a (I PEPTIDASE SIGNAL LEADER) protein domain (PD109753) which is seen in LEP_HAEIN.

Residues 137-258 are 34% similar to a (I PEPTIDASE PROTEASE MEMBRANE) protein domain (PD097109) which is seen in LEP_HAEIN.

Residues 32-117 are 53% similar to a (I PEPTIDASE SIGNAL LEADER) protein domain (PD016559) which is seen in Q9CPH7_PASMU.

Residues 89-201 are 35% similar to a (I PEPTIDASE PROTEASE LEADER) protein domain (PD356885) which is seen in LEP_HELPY.



Paralogs:  Local Blast Search

HD1607 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 72 to 291 (E-value = 7.6e-62) place HD1607 in the Peptidase_S26 family which is described as Signal peptidase I (PF00461)

PDB Hit:
pdb|1B12|A Chain A, Crystal Structure Of Type 1 Signal Peptidas... 235 5e-063
pdb|1B12|A Chain A, Crystal Structure Of Type 1 Signal Peptidas... 385 4e-108

Gene Protein Sequence:
LMMAQIMPIIFIAILYGVWKMLDLMQLPNTISILLVALVFICGSFWSFYK
FSAGPRRKLAINRKEKQLNRPLTEEEKSEIQPPSLIGDFLASLFGVLLFV
TVLRSFIFEPFQIPSGSMEPTLRVGDFLVVNKFSYGIKDPIWQNTLIEIG
HPQRGDVIVFKAPKQPHIDYIKRVIGVGGDKIKYDSKTQQLTVTHADGQQ
NVFTYSDAKANAEFFYHGEMQMERTEKGDITHQILNNPYPFNYEPYLFSQ
DGQMAGEWTVPAGHYFVMGDNRDNSEDSRFWGFVPEQNIVGKATFVWLSL
DKKANELPTGLRFSRMFSAIK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATGATGGCACAAATTATGCCAATTATTTTTATTGCTATTTTGTATGG
TGTTTGGAAAATGTTAGATTTGATGCAATTACCTAATACTATTTCTATTT
TACTCGTTGCATTAGTTTTTATTTGTGGCAGTTTTTGGTCATTCTATAAA
TTTAGTGCCGGACCTCGCCGTAAACTGGCGATTAACCGGAAGGAAAAACA
GTTAAATCGACCGCTTACTGAAGAGGAAAAATCAGAGATACAACCTCCGT
CACTTATAGGTGATTTTTTGGCGTCATTGTTTGGCGTATTGCTATTTGTA
ACGGTTTTACGTTCATTTATTTTTGAGCCATTTCAGATTCCTAGCGGTTC
AATGGAGCCGACGTTACGGGTTGGGGATTTTTTAGTCGTGAATAAATTTA
GTTATGGCATAAAAGATCCTATTTGGCAAAACACTTTAATAGAAATAGGT
CATCCTCAACGAGGTGATGTGATTGTTTTTAAAGCACCAAAACAGCCACA
TATTGATTATATTAAACGTGTGATTGGGGTGGGCGGAGACAAAATCAAAT
ACGATTCAAAAACACAACAATTAACTGTAACGCACGCGGATGGTCAGCAA
AATGTATTTACATACAGTGATGCCAAAGCAAATGCAGAATTCTTTTATCA
CGGCGAAATGCAAATGGAGCGGACTGAAAAAGGCGATATTACGCATCAAA
TTTTGAATAATCCTTATCCATTTAATTATGAGCCATATTTATTTAGTCAA
GATGGGCAAATGGCAGGAGAATGGACCGTACCGGCTGGACATTACTTTGT
CATGGGCGATAACCGTGATAATAGTGAAGATAGCCGTTTTTGGGGCTTTG
TGCCTGAACAAAATATTGTGGGTAAAGCAACATTTGTTTGGTTGAGTTTA
GATAAAAAAGCAAACGAATTACCAACAGGGCTACGTTTTAGCCGAATGTT
TAGTGCAATAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy