Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1167 IGR1172 IGR1170 IGR1171 IGR1173 IGR1168 IGR1169 IGR1174 IGR1166 HD1610 rhlB, - HD1602 rnc, - HD1606 recO, - HD1604 deaD, - HD1603 era, - HD1605 lepB, - HD1607 tpn, - HD1612 HD1601 lepA, - HD1608 HD1609 HD1610 rhlB, - HD1602 rnc, - HD1606 recO, - HD1604 deaD, - HD1603 era, - HD1605 lepB, - HD1607 tpn, - HD1612 HD1601 lepA, - HD1608 HD1609 rhlB, - HD1602 rnc, - HD1606 recO, - HD1604 deaD, - HD1603 era, - HD1605 lepB, - HD1607 tpn, - HD1612 HD1601 lepA, - HD1608 HD1611 HD1610 HD1611 HD1609
* Calculated from Protein Sequence

Gene ID: HD1606

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rnc  

Definition:
ribonuclease III (rnc)

Gene Start:
1327830

Gene Stop:
1327162

Gene Length:
669

Molecular Weight*:
25347

pI*:
8.10

Net Charge*:
1.40

EC:
3.1.26.3  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Powell,B.S., Peters,H.K., Nakamura,Y. and Court,D.L. .
Cloning and analysis of the rnc-era-recO operon from Pseudomonas aeruginosa.
J. Bacteriol 181(16): 5111-3.1999
Medline: 10438789.

Binnie U, Wong K, McAteer S, Masters M.
Absence of RNASE III alters the pathway by which RNAI, the antisense inhibitor of ColE1 replication, decays.
Microbiology 145 ( Pt 11):3089-100.1999
Medline: 10589716.

Franch T, Thisted T, Gerdes K..
Ribonuclease III processing of coaxially stacked RNA helices.
J Biol Chem 274(37):26572-8. 1999
Medline: 10473621.

Takiff,H.E., Chen,S.M. and Court,D.L.
Genetic analysis of the rnc operon of Escherichia coli.
J.Bacteriol. 171(5): 2581-2590.1989.
Medline: 89213943.

Nashimoto,H. and Uchida,H. .
DNA sequencing of the Escherichia coli ribonuclease III gene and its mutations.
Mol. Gen. Genet. 201(1): 25-29.1985
Medline: 6039802.

March,P.E., Ahnn,J. and Inouye,M.
The DNA sequence of the gene (rnc) encoding ribonuclease III of Escherichia coli.
Nucleic Acids Res. 13(13): 4677-4685.1985
Medline: 85269601.

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to ribonuclease III proteins from H. influenzae (1173093), E. coli (133151), P. aeruginosa (7531195), S. typhimurium (gi:), among others.

HD1606 is similar to predicted ribonuclease III"s from T. pallidum (TP0809), C. trachomatis (CT297), U. urealyticum (UU205), C. pneumoniae (CPn0054), M. pneumoniae (MP0297), and M. genitalium (MG367).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0571
COG name: dsRNA-specific ribonuclease
Functional Class: K
The phylogenetic pattern of COG0571 is ----YqvCebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000999 (Ribonuclease III family) with a combined E-value of 7.9e-67.
    IPB000999A    19-28
    IPB000999B    34-70
    IPB000999C    107-125
    IPB000999D    152-171
    IPB000999E    177-187
    IPB000999F    202-213


ProDom Summary:  Protein Domain Search
Residues 3-75 are 71% similar to a (III RIBONUCLEASE HYDROLASE ENDONUCLEASE) protein domain (PD002508) which is seen in RNC_PASMU.

Residues 78-126 are 73% similar to a (III RIBONUCLEASE HYDROLASE RNA-BINDING) protein domain (PD354976) which is seen in RNC_PASMU.

Residues 151-220 are 58% similar to a (RNA-BINDING III DOUBLE-STRANDED NUCLEAR HYDROLASE) protein domain (PD003300) which is seen in RNC_BUCAI.



Paralogs:  Local Blast Search

HD1606 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 35 to 125 (E-value = 7.4e-49) place HD1606 in the Ribonuclease_3 family which is described as RNase3 domain (PF00636)
Residues 153 to 220 (E-value = 4.7e-23) place HD1606 in the dsrm family which is described as Double-stranded RNA binding motif (PF00035)

PDB Hit:
pdb|1DI2|A Chain A, Crystal Structure Of A Dsrna-Binding Domain... 110 2e-025

Gene Protein Sequence:
MYIERLQKKIGYQFANLDYLLQALTHRSAAAKNNERLEFLGDSILNYAIG
QALFERFPQANEGELSRMRATLVREQTLAILARQFDLGEYMKLGAGELKS
GGYRRESILSDCVEAIIAAIYLDAGMDKASERIYAWYQTLLDEMKPGDAQ
KDPKTRLQEFLQGRRLKLPEYEVLDIKGEAHNQIFKVSCKIETFTDIFIG
IGTSRRKAEQNAAEQILLKLNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATATAGAACGATTACAAAAAAAAATAGGTTATCAGTTTGCTAATTT
AGATTATTTATTACAAGCATTAACCCATCGTAGTGCGGCAGCTAAGAATA
ATGAGCGTTTAGAGTTTTTAGGTGATTCAATTTTAAATTATGCCATTGGG
CAAGCGTTATTTGAAAGATTTCCTCAAGCAAATGAGGGAGAACTAAGCCG
TATGAGAGCGACTTTAGTAAGAGAACAAACGCTAGCAATTTTAGCGCGTC
AATTTGATTTAGGTGAATATATGAAATTGGGCGCAGGCGAGTTAAAAAGC
GGTGGTTATCGTCGTGAATCGATCCTTTCTGACTGTGTAGAAGCAATTAT
CGCGGCGATCTATTTAGATGCAGGTATGGATAAGGCGAGCGAGCGAATTT
ACGCGTGGTATCAAACCTTGTTAGATGAAATGAAGCCTGGTGATGCACAA
AAAGATCCGAAAACACGCTTACAAGAATTTTTACAAGGACGTCGTTTAAA
ATTGCCTGAATATGAAGTGCTTGATATTAAAGGTGAAGCACATAACCAAA
TATTTAAAGTCAGTTGTAAGATTGAGACTTTTACTGATATTTTTATTGGC
ATTGGCACCAGTCGCCGTAAAGCAGAGCAAAATGCAGCAGAGCAAATTTT
GCTTAAATTAAACAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy