Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1167 IGR1172 IGR1170 IGR1171 IGR1164 IGR1168 IGR1165 IGR1163 IGR1169 IGR1166 rhlB, - HD1602 rnc, - HD1606 smbA, - HD1597 rpS2, - HD1600 recO, - HD1604 deaD, - HD1603 tsf, - HD1599 era, - HD1605 lepB, - HD1607 HD1601 HD1598 rhlB, - HD1602 rnc, - HD1606 smbA, - HD1597 rpS2, - HD1600 recO, - HD1604 deaD, - HD1603 tsf, - HD1599 era, - HD1605 lepB, - HD1607 HD1601 HD1598 rhlB, - HD1602 rnc, - HD1606 smbA, - HD1597 rpS2, - HD1600 recO, - HD1604 deaD, - HD1603 tsf, - HD1599 era, - HD1605 lepB, - HD1607 HD1601 HD1598
* Calculated from Protein Sequence

Gene ID: HD1601

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1324054

Gene Stop:
1322579

Gene Length:
1476

Molecular Weight*:
54047

pI*:
6.20

Net Charge*:
-3.28

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 4-491 are 68% similar to 12721813 unknown [Pasteurella multocida].

A few significant hits to hypothetical proteins from Pasteurella haemolytica (mainly the C-terminal region, 3978169), E. coli (732050), Mycobacterium tuberculosis (7477228), among others.

No similarity to proteins from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0433
COG name: Predicted ATPase
Functional Class: R
The phylogenetic pattern of COG0433 is AMTk-Qvce-r----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 247-375 are 71% similar to a (COMPLETE PROTEOME MJ1429 PH0932) protein domain (PD005306) which is seen in YJGR_ECOLI.

Residues 247-375 are 84% similar to a (PROTEOME COMPLETE YJGR PM1435) protein domain (PD356217) which is seen in Q9CL13_PASMU.

Residues 15-246 are 74% similar to a (PROTEOME COMPLETE YJGR PM1435) protein domain (PD038851) which is seen in Q9CL13_PASMU.

Residues 376-489 are 43% similar to a (PROTEOME COMPLETE PEPA-GNTV PM1435) protein domain (PD098708) which is seen in Q9CL13_PASMU.



Paralogs:  Local Blast Search
HD1601 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRDYPIAQTNTGQIISLTAKMANRHGLIAGATGTGKTVTLRKLAELFSDD
GVPVFLVDVKGDLSGLAQAGHLTGKVAERIAQFDLGGENYLNSYPVTYWD
LFGQSGIPLRTTISEMGPMLLARLLNLNATQEGLLNLVFRVADDRGLLLI
DLKDLRALLTFVAENAKAFQIEYGNISAASIGAIQRSLLALENEGASNLF
GEPALNLADWIQTHDGKGVINVLNSEKLINSPRLYSAFLLWFMAELFENL
PEVGDLAKPNFVLFFDEAHLLFDGAPKVLVDKIEQVVRLIRSKGVGVYFV
TQNPLDLPDTVLGQLGNRIQHALRAFTPRDQKAVKAAAETFRANKHINVI
EAISQLAVGEALISVLDEKGMPTPVERAYIYPPRSQLAPLSMNERDELVK
QDDLYHYYNQYVDNYSAYEALNAQAKIEQADADSQNNFFAGILSAIFGNK
KKKDQTVAEQIVSKVTQDVTRKLTNQVSKRIVRGLLGAIIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGATTATCCAATTGCTCAAACTAACACAGGTCAAATTATTTCATT
GACAGCGAAAATGGCGAACCGCCACGGATTAATTGCCGGTGCAACAGGAA
CGGGTAAAACGGTGACGTTACGTAAATTAGCTGAGCTATTCAGTGATGAT
GGTGTCCCCGTTTTTCTTGTTGATGTTAAAGGCGATTTGTCAGGGCTAGC
ACAAGCGGGGCATTTAACAGGAAAAGTGGCTGAACGTATTGCACAATTTG
ATTTAGGCGGTGAGAATTACTTAAATTCTTATCCTGTTACATATTGGGAC
CTTTTTGGACAAAGTGGTATCCCTTTGCGCACCACTATTTCAGAAATGGG
GCCAATGTTGCTTGCTCGTTTACTAAATTTAAATGCCACACAAGAAGGAT
TATTGAATTTAGTTTTTAGAGTGGCCGATGATCGTGGTTTATTATTGATT
GATTTGAAAGATTTACGTGCGCTCTTAACGTTTGTGGCTGAAAATGCTAA
AGCATTTCAAATAGAATATGGCAATATTTCAGCCGCTAGTATAGGCGCTA
TTCAGCGTTCATTACTTGCCTTAGAAAATGAAGGTGCGAGCAATTTATTT
GGCGAACCAGCATTGAATTTAGCCGATTGGATACAAACGCACGATGGTAA
AGGCGTAATTAATGTATTGAACTCCGAAAAATTGATTAATTCACCACGTT
TATATAGTGCTTTTTTATTGTGGTTTATGGCAGAGTTATTTGAAAACTTA
CCCGAAGTAGGTGATTTAGCAAAGCCAAACTTTGTATTGTTTTTCGATGA
AGCACATTTATTATTTGATGGCGCGCCCAAAGTGTTGGTGGACAAAATAG
AACAAGTTGTGCGCTTAATTCGCTCAAAAGGTGTTGGCGTTTATTTTGTA
ACACAAAATCCGTTAGATTTACCAGACACTGTGCTTGGTCAATTAGGTAA
TCGAATTCAACATGCCTTACGCGCATTTACGCCACGAGATCAAAAAGCTG
TTAAGGCTGCGGCAGAAACATTTCGTGCGAATAAGCATATTAATGTAATT
GAAGCGATTTCTCAGTTAGCGGTTGGGGAAGCACTTATTTCGGTATTAGA
TGAAAAAGGAATGCCAACTCCGGTTGAACGGGCGTATATTTATCCGCCAA
GAAGTCAGTTAGCCCCTCTTTCTATGAATGAACGAGATGAATTAGTTAAA
CAAGATGATTTATATCACTATTATAACCAATATGTGGATAACTATTCTGC
TTATGAGGCTTTAAATGCTCAAGCTAAAATAGAACAAGCAGATGCAGACA
GTCAAAATAATTTTTTTGCAGGAATATTAAGCGCTATTTTTGGTAATAAA
AAGAAAAAAGATCAAACCGTTGCTGAACAGATAGTCAGTAAAGTGACTCA
GGATGTGACAAGAAAACTGACCAATCAAGTATCTAAACGTATTGTGCGTG
GGCTTTTGGGCGCGATTATTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy