Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1160 IGR1159 IGR1158 IGR1161 IGR1164 IGR1165 IGR1163 IGR1162 IGR1166 frr, - HD1596 smbA, - HD1597 rpS2, - HD1600 tsf, - HD1599 pyrOA,pdxB, - HD1593 HD1601 yfhC, - HD1591 HD1595 HD1598 deaD, - HD1590 frr, - HD1596 smbA, - HD1597 rpS2, - HD1600 tsf, - HD1599 pyrOA,pdxB, - HD1593 HD1601 yfhC, - HD1591 HD1595 HD1598 deaD, - HD1590 frr, - HD1596 smbA, - HD1597 rpS2, - HD1600 tsf, - HD1599 pyrOA,pdxB, - HD1593 HD1601 hisH, - HD1592 hisH, - HD1592 HD1595 HD1598 deaD, - HD1590 HD1594 HD1594 yfhC, - HD1591
* Calculated from Protein Sequence

Gene ID: HD1597

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
smbA  

Definition:
uridylate kinase

Gene Start:
1318826

Gene Stop:
1318113

Gene Length:
714

Molecular Weight*:
25769

pI*:
5.80

Net Charge*:
-2.36

EC:
2.7.4.-  

Functional Class:
Cellular processes; Cell division  
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table

Secondary Evidence:
Serina,L., Blondin,C., Krin,E., Sismeiro,O., Danchin,A., Sakamoto,H., Gilles,A.M. and Barzu,O.
Escherichia coli UMP-kinase, a member of the aspartokinase family, is a hexamer regulated by guanine nucleotides and UTP. Biochemistry 34(15): 5066-5074, 1995.
Medline: 95226394.

Yamanaka,K., Ogura,T., Niki,H., Hiraga,S.
Identification and characterization of the smbA gene, a suppressor of the mukB null mutant of Escherichia coli.
J. Bacteriol. 174(23): 7517-7526, 1992.
Medline: 1447125.

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to uridylate kinases from H. influenzae (1172793), E. coli (267005), Pseudomonas aeruginosa (3417448), among others.

HD1597 is similar to predicted uridylate kinases from C. pneumoniae (CPn0698), C. trachomatis (CT678), U. urealyticum (UU513), M. pneumoniae (MP0210), and M. genitalium (MG434). No similarity to proteins from T. pallidum.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0528
COG name: Uridylate kinase
Functional Class: F
The phylogenetic pattern of COG0528 is amtk-qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 142-191 are 80% similar to a (KINASE TRANSFERASE URIDYLATE BIOSYNTHESIS PROTEOME) protein domain (PD102733) which is seen in PYRH_HAEIN.

Residues 20-141 are 84% similar to a (KINASE URIDYLATE TRANSFERASE 2.7.4.-) protein domain (PD005760) which is seen in Q9CJL5_PASMU.

Residues 193-236 are 88% similar to a (KINASE URIDYLATE TRANSFERASE 2.7.4.-) protein domain (PD406533) which is seen in PYRH_HAEIN.



Paralogs:  Local Blast Search
HD1597 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 216 (E-value = 2.2e-60) place HD1597 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKPIYNRILLKLSGEALQGDEGFGIDPSILDRMALEIKELVEMGVEVGV
VLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAEVNAK
LMSAFQLNGICDTYNWSEAIKMLREKRVVIFSAGTGSPFFTTDSAGCLRG
IEIEADVVLKATKVEGVYDKDPSKFNDAKLYNTLTYAEVIDQELKVMDLA
AFTLARDHNMPIRVFNMGKPGALREVVMGTTEGTTIS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAAACCAATCTATAACCGTATTTTATTAAAACTAAGTGGTGAGGC
ATTGCAAGGCGATGAAGGTTTTGGCATCGATCCGTCAATTTTAGATCGCA
TGGCATTAGAGATTAAAGAATTAGTTGAAATGGGCGTAGAAGTTGGTGTG
GTATTAGGCGGTGGTAATTTATTCCGAGGTGCTAAATTAGCCAAAGCAGG
AATGAATCGCGTGGTGGGTGATCATATGGGAATGCTTGCTACTGTGATGA
ATGGTTTAGCGATGCGTGATGCATTACATCGTGCCGAAGTAAATGCTAAA
TTAATGTCAGCATTTCAGTTAAATGGTATTTGTGATACGTATAACTGGTC
AGAAGCAATTAAAATGTTACGTGAAAAGCGCGTGGTTATTTTTTCGGCGG
GTACGGGGAGCCCATTTTTTACCACTGATTCAGCTGGATGTTTACGCGGT
ATTGAGATTGAAGCCGATGTTGTTTTGAAAGCGACTAAAGTAGAGGGTGT
TTACGATAAAGATCCTAGCAAATTTAATGATGCAAAATTATATAATACGT
TAACTTATGCAGAAGTGATCGATCAAGAATTGAAGGTGATGGATTTAGCC
GCATTTACGCTTGCACGTGATCATAATATGCCTATCCGTGTATTTAATAT
GGGTAAGCCGGGCGCATTACGTGAAGTGGTAATGGGGACAACAGAAGGTA
CAACTATTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy