Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1160 IGR1159 IGR1158 IGR1161 IGR1164 IGR1165 IGR1163 IGR1157 IGR1162 frr, - HD1596 smbA, - HD1597 rpS2, - HD1600 tsf, - HD1599 pyrOA,pdxB, - HD1593 yfhC, - HD1591 HD1589 HD1595 HD1598 deaD, - HD1590 frr, - HD1596 smbA, - HD1597 rpS2, - HD1600 tsf, - HD1599 pyrOA,pdxB, - HD1593 yfhC, - HD1591 HD1589 HD1595 HD1598 deaD, - HD1590 frr, - HD1596 smbA, - HD1597 rpS2, - HD1600 tsf, - HD1599 pyrOA,pdxB, - HD1593 hisH, - HD1592 hisH, - HD1592 yfhC, - HD1591 HD1589 HD1595 HD1598 deaD, - HD1590 HD1594 HD1594
* Calculated from Protein Sequence

Gene ID: HD1595

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
transcription regulator, GntR family homolog

Gene Start:
1315979

Gene Stop:
1317280

Gene Length:
1302

Molecular Weight*:
50551

pI*:
9.50

Net Charge*:
14.95

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1-426 are 57% similar to 15603096 GntR [Pasteurella multocida].

Several significant hits using gapped BLAST to transcriptional regulators (GntR family homologs) from B. subtilis (7444907),
Rhizobium leguminosarum bv. viciae (3411182), Deinococcus radiodurans (7473653), among others. It also has some similarity to a rhizopine catabolism regulatory protein from Sinorhizobium meliloti (1346565; MOCR_RHIME).

No similarity to proteins from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1167
COG name: Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs
Functional Class:  K,E
The phylogenetic pattern of COG1167 is ---kY-v-EB-----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000524 (Bacterial regulatory proteins, GntR family) with a combined E-value of 1.4e-14.
    IPB000524    7-47


ProDom Summary:  Protein Domain Search
Residues 115-362 are 41% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in P96669_BACSU.

Residues 82-144 are 49% similar to a (PROTEOME COMPLETE GNTR REGULATION) protein domain (PD022664) which is seen in Q9CLJ7_PASMU.

Residues 168-245 are 57% similar to a (PROTEOME COMPLETE GNTR REGULATION) protein domain (PD413671) which is seen in Q9CLJ7_PASMU.

Residues 331-426 are 62% similar to a (PROTEOME COMPLETE GNTR) protein domain (PD394251) which is seen in Q9CLJ7_PASMU.

Residues 1-50 are 74% similar to a (PROTEOME COMPLETE DNA-BINDING REGULATION) protein domain (PD266930) which is seen in Q9CLJ7_PASMU.

Residues 246-330 are 77% similar to a (PROTEOME COMPLETE TRANSCRIPTIONAL) protein domain (PD259563) which is seen in Q9CLJ7_PASMU.



Paralogs:  Local Blast Search
HD1595 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LQLNDKLPSKRRLSEHLQISQNTVERAYAQLLAEGYIESKARSGFLVCFQ
SEHTYPTTCYSKKITKITASTNYLLDFNPNKIDIDHFPLKQWKKCANLDH
NTWLNSGDPQGDLNLRQQISQYLLASRGVHCEAEQIIIGAGVESCLQRLI
LLFQQLQPQMNWTMESYGYTTVEKLLNLYHKPIIKMPFSTENYPLDIGFL
TQNKIDIAYLTPSHLYPFGHILTINQRQSLLEWAIAKTGRYIIEDDYDSE
FRYQGKPIPSLQSLDNHGKVIYLGSFSKLLMPSLRITFLVLPKTLLNAYQ
QYCGFLNVTVSRLEQQRLAKFIQTGEFEKHINRMRKVYRRKMELLCQLLM
PYSYCIRYYGEHSGFYLLIELYNETRSLAKLVQLAETHRIKVYPIEYQNK
KLFSLGFGHLTEAQLRKGITQLFDCWQIKPHAV$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAGTTAAATGATAAATTACCTTCAAAGCGCCGTTTATCTGAGCATTT
ACAAATTAGTCAAAATACTGTTGAACGTGCTTATGCACAATTATTAGCGG
AAGGCTATATTGAGTCTAAAGCTCGCAGTGGCTTCTTAGTTTGCTTTCAA
TCAGAACATACTTATCCAACAACCTGTTACAGCAAAAAAATAACAAAAAT
AACCGCTTCTACAAACTATCTACTAGACTTTAATCCAAACAAAATTGATA
TCGATCACTTTCCACTCAAACAATGGAAAAAATGTGCCAACCTTGATCAT
AACACTTGGTTAAACAGTGGCGATCCGCAAGGCGATTTAAATTTACGCCA
ACAAATTTCACAATATCTACTTGCTTCACGTGGTGTTCATTGTGAAGCAG
AACAAATCATTATTGGTGCAGGTGTAGAAAGTTGCTTGCAAAGACTAATT
TTGCTTTTTCAACAATTACAACCTCAAATGAACTGGACAATGGAATCTTA
TGGTTATACTACGGTAGAAAAATTACTCAATTTGTATCATAAACCCATTA
TTAAAATGCCTTTTAGTACAGAAAACTACCCGCTAGATATTGGATTTTTA
ACACAAAATAAGATTGATATAGCTTATTTAACCCCTTCGCACCTCTACCC
TTTTGGGCATATTTTAACCATTAATCAACGGCAATCATTATTAGAATGGG
CCATCGCAAAGACTGGACGTTATATTATTGAGGACGATTATGATAGTGAA
TTTCGCTATCAAGGCAAACCGATTCCTTCATTACAGAGCTTAGATAATCA
CGGTAAAGTGATTTATTTAGGTTCATTTTCTAAACTATTAATGCCCTCAT
TACGCATTACATTTTTGGTGTTACCTAAAACGTTATTAAATGCTTATCAG
CAATATTGTGGTTTTCTCAATGTGACCGTTTCGCGATTAGAACAACAACG
CTTGGCAAAATTTATTCAAACAGGCGAATTTGAAAAACATATTAATCGGA
TGAGAAAAGTGTATCGGCGAAAAATGGAATTACTCTGTCAATTATTAATG
CCCTATTCATATTGTATTCGCTATTATGGCGAACATTCTGGCTTTTACTT
ATTGATTGAGCTATATAATGAAACAAGAAGTTTAGCTAAGCTAGTTCAAT
TGGCAGAAACACATCGCATAAAAGTGTATCCTATTGAATATCAAAATAAA
AAATTATTTAGCTTAGGTTTTGGGCATTTAACGGAAGCACAACTAAGAAA
GGGTATTACGCAATTATTCGATTGCTGGCAAATTAAACCACACGCGGTCT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy