Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1152 IGR1154 IGR1153 IGR1156 IGR1157 IGR1155 HD1586 kicA,mukE, - HD1584 kicB,mukF, - HD1585 gyrA,parC, - HD1587 mukB, - HD1582 HD1589 deaD, - HD1590 pnp, - HD1588 HD1586 kicA,mukE, - HD1584 kicB,mukF, - HD1585 gyrA,parC, - HD1587 mukB, - HD1582 HD1589 deaD, - HD1590 pnp, - HD1588 HD1586 kicA,mukE, - HD1584 kicB,mukF, - HD1585 gyrA,parC, - HD1587 mukB, - HD1582 HD1589 deaD, - HD1590 pnp, - HD1588
* Calculated from Protein Sequence

Gene ID: HD1587

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gyrA  parC  

Definition:
DNA gyrase / topoisomerase IV, subunit A

Gene Start:
1308212

Gene Stop:
1305966

Gene Length:
2247

Molecular Weight*:
83968

pI*:
7.80

Net Charge*:
4.03

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Peng,H. and Marians,K.J. 1993.
Escherichia coli topoisomerase IV. Purification, characterization, subunit structure, and subunit interactions.
J. Biol. Chem. 268(32): 24481-24490.
Medline: 94043292.

Luttinger,A.L., Springer,A.L. and Schmid,M.B. 1991.
A cluster of genes that affects nucleoid segregation in Salmonella typhimurium.
New Biol. 3(7): 687-697.
Medline: 92089025.

Kato,J., Nishimura,Y., Imamura,R., Niki,H., Hiraga,S. and Suzuki,H. 1990.
New topoisomerase essential for chromosome segregation in E. coli. Cell 63(2): 393-404.
Medline: 91004247.

Comment:
For other "gyr" genes, see HD1748 (gyrA), HD0870 (gyrB), HD1643 (gyrB). For other topoisomerases, see HD0413 (I), HD0954 (I), HD1276 (III), HD1385 (I), HD1643(II)

Blast Summary:  PSI-Blast Search
Multiple significant hits were found using gapped BLAST to DNA topoisomerase IV subunit A proteins from H. influenzae (43702), E. coli (129633), Vibrio parahaemolyticus (4886575), Salmonella typhimurium (129634), among others. For instance, residues 8-751 of HD1587 are 72% similar to residues 4-746 of the H. influenzae protein PARC_HAEIN (43702).

HD1587 is similar to two proteins from U. urealyticum (UU082 and UU467), M. pneumoniae (MP0150 and MP0031), M. genitalium (MG004 and MG204), C. pneumoniae (CPn0274 and CPn0716) and C. trachomatis (CT189 and CT660). It is also similar to one protein from T. pallidum (TP0005). All are predicted to be DNA gyrase subunit A proteins.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0188
COG name: DNA gyrase (topoisomerase II) A subunit
Functional Class: L
The phylogenetic pattern of COG0188 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002205 (DNA gyrase/topoisomerase IV, subunit A) with a combined E-value of 4.1e-74.
    IPB002205A    34-52
    IPB002205B    67-102
    IPB002205C    116-130
    IPB002205D    172-193
    IPB002205E    215-224
    IPB002205F    235-244


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search


HD1587 is paralogously related to HD1748 (1e-100).


Pfam Summary:  Pfam Search
Residues 34 to 478 (E-value = 1e-234) place HD1587 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)

PDB Hit:
pdb|1AB4| 59kda Fragment Of Gyrase A From E. Coli 316 6e-087
pdb|1BJT| Topoisomerase Ii Residues 409 - 1201 >gi|1633273|p... 68 4e-012
pdb|1AB4| 59kda Fragment Of Gyrase A From E. Coli 639 0.0

Gene Protein Sequence:
MTKEISYEGVEQMPIKRFTEDAYLNYSMYVIMDRALPFIGDGLKPVQRRI
IYSMSELGLNASAKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSY
RYPLIDGQGNWGAPDDPKSFAAMRYTESKLSKMAEILLNELGQGTVDYQP
NFDGSLAEPQYLPARLPHILLNGTMGIAVGMATDIPPHNINEIAQAGVML
LENPYTTLNELLTVIQGPDYPTEAEIITPKADIVKMYEQGRGSIKMRAVW
KKEENEIVIYALPHQASPSKIIEQIATQMRNKKLPLVEDIRDESDHENPI
RIVLVPRSNRIDFNGLMDHLFATTDLEKSYRVNMNMIGLDGKPAVKNLVT
ILTEWLHFRRTTVVRRLSYRLDKVLNRLHILNGLMTAFLNIDDVIEIIRH
QDEPKAELIERFALTGIQADAILNLRLRHLAKLEEHQLQAEQHQLEHERN
ELQRLLASDRRLNNLIKQEIQQDAKAFVSPRRSPLIERAEAKAIAESDLT
PTEDITVILSEKGWVRCAKGHDIDVQGLSYRAGDGYLAHTRGRSNQPVVF
LDSTGRAYTIDPTTLPSARSQGEPLTSKISLPEGASIQQVLMANPESKML
MASDAGYGFICTFNDLISRNKAGKAVISLPENAKILVPQWIENSDELSIV
AMSTINRMLVFPLTELPTLTKGKGNKIMNIATQAAKEGKELLARLLLIKS
NQSLVFMAGKRKITLKPADIDHYRGERARKGTQLVRGLNVNSTVTIIE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAAAGAAATTAGCTATGAAGGCGTTGAACAAATGCCAATTAAGCG
TTTTACTGAAGATGCTTATCTCAATTATTCAATGTATGTAATTATGGATA
GGGCCTTGCCTTTTATTGGTGATGGTCTTAAGCCTGTGCAACGTCGTATC
ATTTATTCAATGTCAGAATTGGGGTTAAATGCCTCAGCAAAATATAAAAA
ATCAGCACGTACGGTAGGTGATGTGTTGGGTAAATTTCACCCGCATGGCG
ACAGTGCTTGCTATGAAGCGATGGTTTTAATGGCGCAGCCATTTTCTTAT
CGTTATCCATTAATTGATGGGCAAGGTAACTGGGGCGCACCTGATGATCC
TAAATCATTTGCTGCAATGCGTTATACTGAGTCAAAATTGTCTAAAATGG
CTGAAATTCTGTTAAATGAATTAGGACAAGGCACGGTAGATTATCAGCCT
AATTTTGATGGTTCATTAGCGGAGCCACAGTATTTGCCAGCTCGGCTACC
GCATATTTTATTAAATGGTACTATGGGCATTGCTGTTGGAATGGCTACTG
ATATCCCTCCTCATAATATTAATGAAATTGCGCAAGCGGGCGTAATGTTA
TTAGAAAATCCATATACTACTTTAAATGAATTATTAACCGTCATTCAAGG
GCCTGATTATCCGACAGAAGCAGAAATTATTACCCCTAAAGCAGATATTG
TGAAAATGTATGAGCAGGGGCGTGGTTCAATTAAAATGCGTGCTGTGTGG
AAAAAAGAAGAGAATGAAATTGTTATTTATGCCTTACCACATCAGGCATC
ACCTTCTAAAATTATCGAACAAATTGCGACACAAATGCGCAACAAGAAGT
TACCTTTGGTTGAGGATATTCGAGATGAATCGGATCACGAAAATCCTATT
CGGATTGTGTTGGTTCCGCGTTCAAATCGAATTGATTTCAATGGATTAAT
GGATCACTTATTTGCCACTACTGACTTAGAAAAAAGTTATCGTGTCAATA
TGAATATGATTGGTTTAGATGGTAAACCTGCAGTAAAAAATTTAGTGACG
ATTCTAACAGAATGGTTACATTTCCGTCGGACTACTGTTGTACGGCGTTT
ATCTTATCGCTTAGATAAAGTGCTAAATAGATTGCACATTTTAAATGGTT
TAATGACCGCTTTTTTAAATATTGATGATGTGATTGAAATCATTCGCCAT
CAAGATGAACCCAAAGCGGAATTAATTGAGCGCTTTGCTTTAACTGGAAT
TCAAGCAGACGCTATTTTAAATTTACGGTTGCGCCATTTAGCTAAATTAG
AAGAACATCAATTACAAGCCGAACAGCATCAATTAGAACATGAACGAAAT
GAATTACAACGTTTATTGGCTTCTGATCGTCGGCTAAATAACTTAATTAA
GCAAGAAATTCAGCAAGATGCAAAAGCATTTGTGAGTCCGCGACGTTCTC
CATTAATTGAACGCGCAGAAGCAAAAGCGATTGCTGAAAGTGATCTGACG
CCAACAGAAGATATTACGGTTATTTTGTCTGAAAAAGGTTGGGTACGTTG
TGCAAAAGGGCATGATATTGATGTACAAGGGCTGAGTTATCGTGCCGGTG
ATGGTTATTTAGCTCATACACGAGGTCGTAGTAATCAGCCTGTTGTTTTC
TTAGACAGCACTGGCCGTGCTTATACGATTGATCCAACCACCTTGCCATC
AGCACGTTCACAAGGCGAACCTTTAACTAGCAAAATTAGTTTGCCAGAAG
GCGCAAGCATACAGCAAGTATTGATGGCAAATCCAGAAAGCAAGATGTTG
ATGGCATCTGATGCGGGCTATGGTTTTATTTGTACTTTTAATGATCTTAT
TTCTCGCAATAAAGCCGGTAAAGCGGTTATTTCTTTGCCGGAAAATGCTA
AAATATTAGTGCCACAATGGATTGAAAATAGCGATGAACTGTCGATTGTT
GCAATGAGCACTATCAATAGAATGTTAGTCTTCCCATTAACAGAATTACC
TACCCTTACTAAAGGAAAAGGCAATAAAATTATGAATATTGCCACACAAG
CGGCAAAAGAAGGCAAAGAATTGCTAGCCCGTTTGTTGTTAATTAAATCT
AATCAGTCACTTGTTTTTATGGCGGGCAAACGTAAAATCACACTTAAACC
AGCAGATATTGATCACTATCGTGGTGAACGTGCACGTAAAGGAACACAAC
TTGTCCGGGGCCTAAATGTTAATTCAACGGTCACTATTATAGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy