Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1145 IGR1148 IGR1149 IGR1146 IGR1144 IGR1150 IGR1147 IGR1151 mukB, - HD1582 HD1576 HD1578 HD1577 HD1575 HD1573 HD1572 HD1581 HD1574 HD1580 mukB, - HD1582 HD1576 HD1578 HD1577 HD1575 HD1573 HD1572 HD1581 HD1574 HD1580 mukB, - HD1582 HD1577 HD1575 HD1573 HD1572 HD1581 HD1574 HD1580 HD1578 HD1576
* Calculated from Protein Sequence

Gene ID: HD1580

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1295241

Gene Stop:
1298030

Gene Length:
2790

Molecular Weight*:
103785

pI*:
5.60

Net Charge*:
-14.29

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two hits in gapped BLAST to hypothetical protein sequences, e.g.residues 220-775 and residues 1-195 are 34% similar to hypothetical protein in Xylella fastidiosa strain 9a5c (11292989|). See also gi 22995506.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 220-775 are 30% similar to a (PROTEOME COMPLETE XF0526 XF2115) protein domain (PD361375) which is seen in Q9PFY0_XYLFA.



Paralogs:  Local Blast Search
HD1580 is paralogously related to HD0538 (0.0), HD0154 (0.0), HD0155 (1e-67) and HD0153 (2e-49).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGGKRKGGAVTVGYRYYWDIHSGLGRGPVDEIVELRIDDKSAYVGKPNEL
THSQAIYIDKPNLFGGENTGGEGGIQGRLEILMGEPDQKPTQMLVNLLKG
NQNPAPAQSNSSRLRKAGQRKKQQAQQDFFKAGELTDAAISKDDMIPGFR
GIVSTVFSGLISCYNAHPKKHSYRLRRNNKGWHGGAVWYPEKCKIMLRND
TLKISGLTKEQEENVRQIHAMNPAHILVECATNKSWGGKKDLSDLDLDSY
KKAADTLYEEGFGLCLRYNRQGSIKEFMQQVIDHIGAVQYDNVETGKQAI
RLLRNDYNPDDLPTFHYDNGILMVQDDDSSATDTTANQIIVKWRDPVTNR
EDQAIANNIASVQMHGVIAKTVEYKGVPTFDLAARLAQRDLEMVASSLTR
LKIVFDMRASELKHGDVFKVHLPERGIESAVFRVSAIENGNEGELIVTCM
QDVFGLPAANYSTRQSESLYIPPDYTAKPIQNSRLFELPYHVYPLVFSEA
ELAFIKPTDCFVWSLASQPSALAVGYDLLTDVGAGFTPVAECSFVPSVTL
SSDITPYQTTVSFVSGDEFADLANAGALMIDDEIVKIESVDFKNSIMTIG
RGCADTIPQAHKQGTTAWCYLLTTSDTDTKYTANEQIKAKLLTRTQIETL
SEDAANVLTLTTQQRQARPYPPANVKVDGVFVDKIADSSAFTLTWAHRDR
DIQADQLISHTEDSTALGKGVSYKIDLMDGNNIVRSITTDSTTFVYPDEG
KIEDEQFSKLVFYTVKDKLTSLYRYEFTVQGAMQLLSDWDYQRAFTQGND
YFNRYDDNDMPTGKYIMLSSSADKESIIYQSFVLEPNKYKRFALSYKVGT
YNQRNGLCTVTIQLYKGTVLLKEYASEQLGNWQKNDWHSQQVAEILPAET
TEIRFKINVVGSISNNVIAFKDIVLRVGG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTGGCAAACGTAAAGGCGGTGCGGTAACGGTCGGTTATCGTTACTA
CTGGGATATTCATTCAGGGCTTGGGCGTGGACCAGTGGATGAAATTGTCG
AGTTACGTATTGATGATAAATCAGCCTATGTGGGCAAACCGAATGAGCTA
ACCCACTCACAAGCGATTTATATTGACAAACCAAACTTGTTCGGGGGTGA
AAACACAGGGGGTGAAGGCGGTATTCAAGGGCGGTTAGAGATTCTCATGG
GCGAACCTGATCAAAAGCCGACACAAATGCTAGTTAATCTGTTAAAGGGC
AATCAAAACCCTGCTCCTGCCCAATCGAATAGCTCCCGCTTACGTAAAGC
AGGACAACGCAAAAAACAGCAAGCTCAGCAAGACTTTTTCAAAGCAGGCG
AGCTAACTGATGCTGCTATATCTAAAGATGACATGATCCCTGGTTTTCGC
GGTATTGTCTCGACCGTGTTTAGTGGGCTGATTAGTTGCTATAACGCTCA
CCCGAAAAAACACAGTTATCGCCTACGTCGTAACAATAAAGGTTGGCACG
GCGGTGCGGTATGGTATCCAGAAAAATGCAAAATTATGTTACGCAATGAC
ACGTTAAAAATTTCAGGGCTCACGAAAGAGCAAGAAGAAAATGTGCGCCA
AATCCACGCCATGAACCCTGCACATATTCTGGTTGAGTGTGCGACCAATA
AAAGTTGGGGTGGTAAAAAAGACTTAAGTGATCTTGATTTAGATAGCTAC
AAAAAAGCCGCGGATACACTGTATGAAGAAGGCTTTGGCTTATGCTTGCG
CTACAATCGCCAAGGCTCGATTAAAGAGTTTATGCAACAGGTTATCGACC
ATATTGGGGCTGTGCAGTACGACAACGTGGAAACAGGTAAACAAGCCATT
CGTTTATTGCGTAACGATTACAATCCTGACGATTTGCCCACATTTCACTA
TGATAACGGGATTTTAATGGTGCAAGATGATGACAGTTCGGCAACGGATA
CAACCGCCAATCAAATTATCGTGAAATGGCGCGACCCAGTGACAAACCGT
GAAGACCAAGCTATTGCGAATAATATTGCGTCTGTACAAATGCACGGTGT
TATCGCTAAAACAGTGGAATATAAAGGTGTGCCGACGTTTGACTTAGCAG
CTCGCCTTGCACAGCGTGATTTGGAGATGGTCGCCAGCAGTTTAACTCGT
CTTAAGATTGTGTTTGATATGCGTGCTAGCGAATTGAAACACGGCGATGT
TTTCAAAGTACATTTACCGGAACGTGGCATTGAAAGTGCGGTTTTTCGCG
TCAGTGCCATTGAAAACGGTAACGAGGGTGAGTTGATTGTGACTTGTATG
CAAGATGTGTTCGGTTTACCGGCTGCGAATTACTCAACACGACAATCTGA
GTCGCTTTATATTCCACCGGACTATACCGCAAAACCGATTCAAAATAGCC
GATTATTTGAATTGCCATACCATGTTTACCCTTTAGTCTTTAGCGAAGCG
GAATTGGCATTTATTAAACCAACGGATTGCTTTGTGTGGTCGCTGGCAAG
TCAGCCAAGTGCTTTAGCCGTGGGTTATGATTTACTTACTGATGTAGGGG
CAGGCTTTACACCGGTAGCAGAATGCTCATTTGTACCATCAGTAACACTC
AGTTCAGACATTACGCCGTATCAAACTACAGTGAGTTTTGTTTCCGGAGA
TGAGTTTGCGGATTTAGCGAATGCCGGTGCATTAATGATTGATGACGAGA
TTGTCAAAATTGAGTCGGTCGATTTTAAAAACTCAATAATGACTATCGGT
CGCGGCTGTGCAGATACTATCCCGCAAGCACATAAACAAGGTACTACTGC
ATGGTGTTATTTGCTTACGACATCAGATACTGACACAAAATATACCGCAA
ATGAGCAAATTAAAGCGAAATTACTCACCCGTACACAGATTGAAACGCTT
TCTGAAGATGCGGCTAATGTATTAACACTCACCACACAGCAACGACAAGC
GCGACCTTACCCACCGGCAAATGTAAAAGTAGACGGTGTATTTGTTGATA
AGATTGCAGACAGTTCAGCCTTTACACTTACATGGGCGCATCGCGATAGA
GATATTCAAGCCGACCAGCTTATTTCACATACTGAAGACAGTACTGCACT
AGGGAAAGGTGTCAGCTATAAAATTGATTTAATGGACGGTAATAACATAG
TGCGGTCAATTACAACCGATTCTACAACGTTTGTTTATCCGGACGAGGGC
AAAATCGAGGATGAGCAATTTAGCAAACTGGTGTTCTACACGGTGAAAGA
TAAGCTGACAAGCCTGTATCGCTATGAGTTTACCGTGCAAGGTGCAATGC
AATTATTAAGTGATTGGGATTATCAACGCGCATTTACACAAGGTAATGAT
TACTTCAATCGTTATGATGATAACGATATGCCGACAGGTAAATATATCAT
GCTGTCATCAAGTGCGGATAAAGAGAGCATTATTTATCAATCATTTGTGC
TCGAACCTAATAAATATAAACGCTTTGCGCTCTCGTACAAAGTCGGTACA
TATAATCAGCGCAACGGACTTTGTACTGTTACCATACAACTTTATAAAGG
TACTGTTCTGCTTAAAGAATATGCTTCAGAACAACTTGGCAACTGGCAAA
AAAATGATTGGCATAGCCAACAAGTGGCAGAAATCTTACCGGCAGAAACA
ACAGAAATTAGATTTAAGATTAATGTGGTTGGCTCAATATCAAACAATGT
GATTGCATTTAAAGATATTGTTTTACGAGTGGGAGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy