Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1143 IGR1145 IGR1148 IGR1149 IGR1146 IGR1144 IGR1150 IGR1147 HD1576 HD1578 HD1577 HD1575 HD1573 HD1572 HD1581 HD1574 HD1571 HD1580 HD1569 HD1576 HD1578 HD1577 HD1575 HD1573 HD1572 HD1581 HD1574 HD1571 HD1580 HD1569 HD1577 HD1575 HD1573 HD1572 HD1581 HD1574 HD1571 HD1580 HD1569 HD1578 HD1576
* Calculated from Protein Sequence

Gene ID: HD1574

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1292917

Gene Stop:
1293903

Gene Length:
987

Molecular Weight*:
37291

pI*:
7.10

Net Charge*:
0.57

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Only one significant hit in gapped BLAST to a hypothetical protein sequence;e.g residues 1-326 are 30% similar to a hypothetical protein in Xylella fastidiosa strain 9a5c (11346120|). See also gi 15837124.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-326 are 30% similar to a (PROTEOME COMPLETE XF0522) protein domain (PD322297) which is seen in Q9PFY4_XYLFA.



Paralogs:  Local Blast Search
HD1574 is paralogously related to HD0532 (0.0) and HD0148 (1e-123).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLYAYGARVWALPIFTHQVYLDKPTKPGDKTLSLATTGFDFYVGGRAVLM
NGNKREMVDITGIEPDKLEIKRSLLNRFDTSTVVYPLRSAVLTDMPQLTR
LSDEVATAQIRLQIHEHNGYAADIRHLPTYRGHPVLEPTSEWSEDITAQY
LRLIKQLDNGTALPHYLDTAKNAFQLTNHRFLLDSIEAQHKLRQLFYYLR
GRQKAIWVASSTSDLTLANDIVGKNLDIELVYYTTCLLKQAGRQDIRIEC
TDGSVHYRRILAATVSNNQTERLALDGEALNLKREQVAKISFLTLSRLES
DTIDWVHHTDTVASVTVSFRGLRDELEV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTACGCTTACGGTGCAAGGGTGTGGGCATTGCCAATTTTTACTCA
TCAAGTCTATTTAGACAAGCCAACTAAACCAGGCGATAAAACGTTATCAC
TTGCCACCACGGGCTTTGACTTTTATGTCGGTGGGCGTGCGGTTTTGATG
AACGGGAACAAACGTGAAATGGTGGATATTACCGGCATTGAGCCTGATAA
GCTTGAAATAAAACGTTCGTTACTGAATCGCTTTGATACCAGCACCGTGG
TTTATCCGCTACGCTCCGCCGTGCTGACCGATATGCCACAACTTACTCGT
TTAAGTGATGAGGTGGCAACCGCACAAATTCGCCTGCAAATTCACGAGCA
CAATGGCTATGCCGCTGATATTCGTCACTTGCCGACTTATCGCGGACATC
CGGTTTTAGAGCCAACCAGCGAATGGTCGGAAGATATTACCGCACAATAC
TTACGTTTGATTAAACAACTGGATAACGGCACGGCATTACCGCATTACTT
AGATACGGCTAAAAATGCGTTTCAGCTGACAAACCATCGTTTCTTACTCG
ATAGTATTGAAGCACAACACAAACTGCGCCAGCTTTTTTATTACTTACGC
GGCAGACAAAAAGCGATTTGGGTAGCAAGTTCGACATCAGATTTAACACT
AGCAAACGATATTGTCGGCAAAAATCTCGATATTGAGCTGGTTTATTACA
CGACTTGCTTATTGAAACAAGCGGGACGGCAAGACATTCGCATTGAGTGT
ACCGACGGCAGCGTGCATTACCGCCGGATTTTAGCCGCAACGGTAAGCAA
CAACCAAACCGAACGGCTTGCGCTGGATGGTGAAGCGTTAAATTTAAAGC
GTGAACAAGTGGCTAAGATTTCTTTTCTGACACTCTCACGCTTAGAGAGC
GACACGATTGACTGGGTACATCATACCGACACCGTAGCAAGTGTGACGGT
TAGTTTCCGAGGGTTGCGTGATGAACTCGAAGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy