Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1139 IGR1138 IGR1140 IGR1141 IGR1142 IGR1137 HD1568 HD1563 HD1567 HD1558 HD1562 HD1565 HD1561 HD1571 HD1559 HD1569 HD1568 HD1563 HD1567 HD1558 HD1562 HD1565 HD1561 HD1571 HD1559 HD1569 HD1568 HD1567 HD1558 HD1562 HD1565 HD1561 HD1571 HD1559 HD1569 HD1564 HD1560 HD1560 HD1563 HD1564
* Calculated from Protein Sequence

Gene ID: HD1567

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1286032

Gene Stop:
1286451

Gene Length:
420

Molecular Weight*:
15696

pI*:
4.70

Net Charge*:
-6.28

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-115 are 33% similar to 15837121 hypothetical protein
[Xylella fastidiosa 9a5c]. No other matches in gapped BLAST at this time.



COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1567 is paralogously related to HD0525 (3e-77) and HD0137 (5e-38).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQKNDELNVLFPNEKITIAGEEIEVKEYSLIQQLQHRALFMPFVTALRGT
LSKAEAEFGLDGLMNLIAEHYQDVLHLVSISVGKPLEWVQNLTGEDAETV
LMMWWTVNSDFFTRQAVQPMLEKMAQANLKSVGVKSSSN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAAAAATGATGAATTAAATGTGTTGTTCCCGAATGAGAAAATCAC
TATTGCGGGCGAAGAAATCGAAGTCAAAGAATACTCTTTAATCCAACAAT
TACAGCACCGTGCGTTGTTTATGCCATTTGTTACGGCATTGCGTGGCACG
TTAAGTAAAGCTGAAGCGGAGTTTGGTTTAGATGGTTTGATGAACCTTAT
TGCCGAACATTACCAAGATGTACTGCATTTAGTCAGTATTTCGGTGGGTA
AACCACTTGAATGGGTACAGAATCTGACAGGCGAAGATGCCGAAACGGTG
TTAATGATGTGGTGGACGGTAAATAGCGATTTTTTTACCCGTCAGGCGGT
ACAGCCGATGTTAGAGAAAATGGCGCAGGCGAACCTGAAATCTGTTGGGG
TGAAATCGTCGAGCAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy