Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1139 IGR1138 IGR1140 IGR1141 IGR1136 IGR1142 IGR1137 HD1568 HD1563 HD1567 HD1558 HD1562 HD1565 HD1561 HD1571 HD1559 HD1557 HD1569 HD1568 HD1563 HD1567 HD1558 HD1562 HD1565 HD1561 HD1571 HD1559 HD1557 HD1569 HD1568 HD1567 HD1562 HD1565 HD1561 HD1571 HD1559 HD1557 HD1569 HD1564 HD1560 HD1560 HD1563 HD1558 HD1564
* Calculated from Protein Sequence

Gene ID: HD1565

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1285231

Gene Stop:
1285974

Gene Length:
744

Molecular Weight*:
27348

pI*:
5.30

Net Charge*:
-4.26

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 5-245 are 34% similar to 17545582 a conserved hypothetical protein [Ralstonia solanacearum].

Otherwise, a weak hit in gapped BLAST to a hypothetical protein sequence: residues 1-245 are 23% similar to a hypothetical protein in Xylella fastidiosa strain 9a5c (11346118|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1565 is paralogously related to HD0523 (1e-139) and HD0136 (4e-97).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRTESYSYGQGAVYLAERLPNGQPGAFRWVGDVSELSVSLSVEEFTHKES
YSGQRQEVKKIITGKSGEVLIKFHEMSKENLSLMLLGEASTIKAGNVTKE
ALPDDIKAGDRIALAHQNVSDVKIAELKENTDFVVDAIFGTIEFLKEQKS
KKLTVDYNYGDVDVIALLTTNPKDLFLRFEGINLAETNEWNLVELYKINF
NPTEALNLINNENALDALSAKAKVLADTTKAGDSTLGRFGRVVKIKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAACAGAAAGTTACAGCTACGGTCAAGGTGCAGTCTATCTGGCTGA
ACGTTTACCGAACGGGCAACCCGGCGCATTCCGCTGGGTCGGTGATGTGT
CGGAACTATCCGTGTCTTTAAGCGTGGAAGAATTTACACACAAAGAATCT
TACAGCGGTCAGCGTCAAGAAGTGAAGAAAATCATCACAGGTAAATCCGG
TGAAGTTTTAATCAAATTTCACGAAATGAGCAAAGAAAACCTGAGCTTAA
TGCTTTTGGGCGAAGCCAGCACAATTAAAGCAGGTAATGTAACAAAAGAA
GCATTGCCTGATGATATTAAAGCCGGCGATCGTATTGCTTTAGCACATCA
AAATGTGAGCGATGTGAAAATTGCTGAATTAAAAGAAAACACGGATTTTG
TTGTTGATGCGATTTTCGGGACGATTGAGTTTTTAAAAGAACAAAAAAGC
AAGAAATTAACTGTCGATTACAACTATGGCGATGTTGATGTTATTGCACT
TTTAACTACTAACCCGAAAGATTTATTCCTACGTTTCGAAGGCATTAACT
TAGCTGAAACGAATGAATGGAATCTTGTTGAGTTGTACAAAATCAACTTC
AATCCGACAGAAGCCTTGAATTTAATCAACAACGAAAATGCGCTTGATGC
GTTAAGTGCGAAAGCCAAAGTGTTAGCCGATACGACTAAGGCGGGTGATA
GCACGCTCGGGCGTTTCGGGCGCGTTGTTAAGATTAAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy