Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1133 IGR1135 IGR1131 IGR1134 IGR1127 IGR1128 IGR1132 IGR1129 IGR1130 HD1547 HD1553 HD1552 HD1548 HD1541 HD1546 HD1540 HD1542 HD1554 HD1549 HD1543 HD1556 HD1555 HD1547 HD1553 HD1552 HD1548 HD1541 HD1546 HD1540 HD1542 HD1554 HD1549 HD1543 HD1556 HD1555 HD1547 HD1540 HD1542 HD1554 HD1543 HD1556 HD1555 HD1545 HD1550 HD1557 HD1557 HD1552 HD1546 HD1549 HD1541 HD1545 HD1550 HD1553 HD1548
* Calculated from Protein Sequence

Gene ID: HD1552

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1275253

Gene Stop:
1275603

Gene Length:
351

Molecular Weight*:
13507

pI*:
9.10

Net Charge*:
1.24

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 2-109 are 28% similar to >16767466 putative inner membrane protein [Salmonella typhimurium LT2]. Otherwise, there are only weak Blast hits.



COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1552 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIEISGWQVVTYFVGLVITIIGMLIGFGKILLAQFESKLNEKFKFSEERY
RRLHDDIKAAKELSETANKTVMELKVTMPNEYQRREDAIRSETVNSARFD
TINEKLDKVILMYGRN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGAAATTAGTGGATGGCAGGTTGTCACCTATTTTGTGGGATTGGT
CATCACCATTATAGGTATGCTAATAGGCTTCGGTAAAATTTTACTAGCGC
AATTTGAATCGAAACTCAATGAGAAATTCAAGTTTAGCGAAGAACGTTAT
CGTCGCTTACATGATGACATTAAAGCAGCAAAAGAATTATCTGAAACTGC
CAATAAAACCGTTATGGAACTAAAAGTAACGATGCCGAATGAATATCAGC
GGCGTGAGGATGCCATCCGTAGTGAAACTGTTAATTCCGCGCGGTTCGAT
ACCATTAACGAAAAATTAGATAAAGTGATTTTAATGTATGGACGAAATTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy