Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1133 IGR1120 IGR1135 IGR1131 IGR1123 IGR1134 IGR1125 IGR1127 IGR1124 IGR1119 IGR1128 IGR1121 IGR1122 IGR1132 IGR1129 IGR1130 HD1539 HD1537 HD1534 HD1538 HD1533 HD1547 HD1532 HD1535 HD1553 HD1552 HD1548 HD1541 HD1546 HD1540 HD1542 HD1554 HD1549 HD1543 HD1556 HD1555 HD1539 HD1537 HD1534 HD1538 HD1533 HD1547 HD1532 HD1535 HD1553 HD1552 HD1548 HD1541 HD1546 HD1540 HD1542 HD1554 HD1549 HD1543 HD1556 HD1555 HD1538 HD1547 HD1532 HD1537 HD1533 HD1539 HD1534 HD1535 HD1540 HD1542 HD1554 HD1543 HD1556 HD1555 HD1545 HD1550 HD1552 HD1546 HD1549 HD1541 HD1545 HD1550 HD1553 HD1548
* Calculated from Protein Sequence

Gene ID: HD1547

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1273601

Gene Stop:
1273269

Gene Length:
333

Molecular Weight*:
12439

pI*:
5.10

Net Charge*:
-1.87

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 51-107 are 59% similar to 18466689 hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi]. No other matches in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1547 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MYQFFSHINPFGKVYDLPPLTTTETTMQKLTLDYIKSLIVNADYQRFGDT
LTVCVLTLKNGFTVTGESACINKADFNADIGQKIAYDNAVEKIWQLEGYL
AVQRKYEAAL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATCAATTTTTTTCTCATATTAACCCTTTCGGCAAGGTATATGATTT
ACCGCCATTAACTACAACGGAGACAACTATGCAAAAACTTACTTTAGACT
ACATCAAAAGCCTTATTGTCAATGCTGACTATCAACGTTTCGGTGATACT
TTAACGGTATGTGTTTTAACCCTGAAAAATGGGTTTACCGTAACGGGAGA
AAGTGCTTGTATCAACAAAGCAGATTTTAATGCTGACATCGGACAAAAAA
TTGCTTACGACAATGCAGTAGAGAAAATTTGGCAGTTAGAGGGGTATTTA
GCAGTACAACGCAAATATGAAGCTGCCTTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy