Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1120 IGR1131 IGR1123 IGR1125 IGR1127 IGR1124 IGR1119 IGR1128 IGR1121 IGR1122 IGR1129 IGR1130 HD1539 HD1537 HD1534 HD1538 HD1533 HD1547 HD1532 HD1529 HD1535 HD1548 HD1541 HD1546 HD1540 HD1542 HD1549 HD1543 HD1539 HD1537 HD1534 HD1538 HD1533 HD1547 HD1532 HD1529 HD1535 HD1548 HD1541 HD1546 HD1540 HD1542 HD1549 HD1543 HD1538 HD1533 HD1547 HD1532 HD1529 HD1530 eha, - HD1528 HD1530 eha, - HD1528 HD1539 HD1534 HD1537 HD1535 HD1540 HD1542 HD1543 HD1545 HD1550 HD1546 HD1549 HD1541 HD1545 HD1550 HD1548
* Calculated from Protein Sequence

Gene ID: HD1538

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1270048

Gene Stop:
1269854

Gene Length:
195

Molecular Weight*:
7211

pI*:
10.50

Net Charge*:
5.46

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 7 to 61 are 49% ( EScore : 3e-09 ) identical to
HREF="http://www.ncbi.nlm.nih.gov:80/entrez/query.fcgi?cmd=Retrieve&db=Protein&list_uids=7226243&dopt=GenBank" target="_blank">gb|AAF41405.1| (AE002451)
hypothetical protein between residues 27 and 81 in [Neisseria meningitidis MC58]
Residues 15 to 61 are 42% ( EScore : 7e-04 ) identical to gb|AAF41406.1| (AE002451) hypothetical protein between residues 23 and 69 in [Neisseria meningitidis MC58]


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1538 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKDTVKTITQVKQEFYEKGLTFQQWAKENGYDRTYVSMVLNGRIKATHGK
GHEIAVKLGLKAAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGATACAGTAAAAACCATCACGCAAGTGAAACAGGAATTTTATGA
AAAAGGGCTGACGTTTCAGCAATGGGCAAAGGAGAACGGTTATGACCGCA
CTTATGTGTCTATGGTACTGAATGGACGGATTAAAGCCACACACGGCAAG
GGACACGAAATTGCGGTGAAACTTGGCTTAAAAGCGGCGGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy