Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1120 IGR1123 IGR1125 IGR1127 IGR1124 IGR1119 IGR1128 IGR1121 IGR1122 IGR1129 IGR1130 HD1539 HD1537 HD1534 HD1538 HD1533 HD1547 HD1525 HD1532 HD1529 HD1535 HD1548 HD1541 HD1546 HD1540 HD1542 HD1543 HD1539 HD1537 HD1534 HD1538 HD1533 HD1547 HD1525 HD1532 HD1529 HD1535 HD1548 HD1541 HD1546 HD1540 HD1542 HD1543 HD1538 HD1533 HD1547 HD1532 HD1529 HD1524 HD1530 eha, - HD1528 HD1530 eha, - HD1528 HD1526 HD1539 HD1534 HD1525 HD1524 HD1537 HD1526 HD1535 HD1548 HD1540 HD1542 HD1543 HD1545 HD1546 HD1541 HD1545
* Calculated from Protein Sequence

Gene ID: HD1533

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1269204

Gene Stop:
1268902

Gene Length:
303

Molecular Weight*:
11017

pI*:
10.70

Net Charge*:
5.18

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two Blast hits to hypothetical proteins of Neisseria meningitidis are observed:

Residues 10 to 95 are 36% ( EScore : 9e-08 ) identical to emb|CAB84483.1| (AL162755) hypothetical protein NMA1223 between residues 8 and 93 in [Neisseria meningitidis]
Residues 10 to 95 are 36% ( EScore : 9e-08 ) identical to gb|AAF41404.1| (AE002451) hypothetical protein between residues 10 and 95 in [Neisseria meningitidis MC58]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 10-95 are 36% similar to a (PROTEOME COMPLETE NMB1003 NMA1223) protein domain (PD353646) which is seen in Q9JZL3_NEIMB.



Paralogs:  Local Blast Search
HD1533 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSREKLNTTQRALRILKALKGRSLTGLTNKELCEAIGETPVNVTRAIAFL
EAEGFVQRLNTGAYGLSYQILQIAVSHETEMQKASERLAQVRARVQAGAF
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCCGTGAGAAATTAAACACCACGCAACGGGCGTTGCGGATTTTGAA
AGCCTTGAAAGGCAGAAGTTTGACAGGACTAACCAATAAGGAACTGTGTG
AAGCGATTGGCGAAACGCCAGTGAATGTCACCCGAGCTATTGCCTTTTTA
GAAGCGGAAGGTTTTGTGCAACGGTTAAACACTGGGGCGTATGGTTTGAG
TTATCAGATTTTGCAGATTGCAGTAAGCCACGAGACGGAAATGCAGAAAG
CCTCGGAACGATTGGCACAGGTGCGAGCAAGGGTGCAAGCGGGTGCTTTT
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy